Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

58191

Name

CXCL16

Synonym

CXCLG16|SR-PSOX|SRPSOX;chemokine (C-X-C motif) ligand 16;CXCL16;chemokine (C-X-C motif) ligand 16

Definition

C-X-C motif chemokine 16|CXC chemokine ligand 16|scavenger receptor for phosphatidylserine and oxidized low density lipoprotein|small-inducible cytokine B16|transmembrane chemokine CXCL16

Position

17p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Chemokine receptors bind chemokines;PID Reactome;500406

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Disease

Renal Cell cancer;FunDO

Disease

Heart valve disease;FunDO

Disease

Prostate cancer;FunDO

Disease

Coronary Artery Disease;GAD

Disease

Cholangitis;FunDO

Disease

Hepatitis;FunDO

Disease

atherosclerosis, coronary;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Pancreas cancer;FunDO

Disease

Neurilemmoma;FunDO

Disease

Bacterial infection;FunDO

Disease

Enteritis;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

58191

Links to all GeneRIF Items

58191

Links to iHOP

58191

Sequence Information

Nucleotide Sequence

>58191 : length: 822
atgtctgggagtcagagcgaggtggctccatccccgcagagtccgcggagccccgagatg
ggacgggacttgcggcccgggtcccgcgtgctcctgctcctgcttctgctcctgctggtg
tacctgactcagccaggcaatggcaacgagggcagcgtcactggaagttgttattgtggt
aaaagaatttcttccgactccccgccatcggttcagttcatgaatcgtctccggaaacac
ctgagagcttaccatcggtgtctatactacacgaggttccagctcctttcctggagcgtg
tgtgggggcaacaaggacccatgggttcaggaattgatgagctgtcttgatctcaaagaa
tgtggacatgcttactcggggattgtggcccaccagaagcatttacttcctaccagcccc
ccaatttctcaggcctcagagggggcatcttcagatatccacacccctgcccagatgctc
ctgtccaccttgcagtccactcagcgccccaccctcccagtaggatcactgtcctcggac
aaagagctcactcgtcccaatgaaaccaccattcacactgcgggccacagtctggcagct
gggcctgaggctggggagaaccagaagcagccggaaaaaaatgctggtcccacagccagg
acatcagccacagtgccagtcctgtgcctcctggccatcatcttcatcctcaccgcagcc
ctttcctatgtgctgtgcaagaggaggagggggcagtcaccgcagtcctctccagatctg
ccggttcattatatacctgtggcacctgactctaatacctga

Protein Sequence

>58191 : length: 273
MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCG
KRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKE
CGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSD
KELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAA
LSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT



')