Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5784

Name

PTPN14

Synonym

PEZ|PTP36;protein tyrosine phosphatase, non-receptor type 14;PTPN14;protein tyrosine phosphatase, non-receptor type 14

Definition

cytoskeletal-associated protein tyrosine phosphatase|protein-tyrosine phosphatase pez|tyrosine-protein phosphatase non-receptor type 14

Position

1q32.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

5784

Links to all GeneRIF Items

5784

Links to iHOP

5784

Sequence Information

Nucleotide Sequence

>5784 : length: 3564
atgccttttggtctgaagctccgccggacacggcgctacaacgtcctgagcaagaactgc
tttgtcacacggattcgcctgctggacagcaatgttatcgagtgcacgctgtcggtggaa
agcacagggcaagaatgcctggaggctgtggcccagaggctggagctgcgagagacgcac
tactttggcctttggtttctcagcaagagccagcaagcacgatgggtggagctggagaaa
cctctgaagaaacatctggacaaattcgctaatgagcctttgcttttctttggagtcatg
ttctatgtgccaaatgtgtcatggcttcagcaagaggccacaagatatcagtattacctg
caagtcaaaaaagatgtgcttgaagggcgattacgatgtacattggaccaggtgattcgg
ctagccggcctagctgtgcaagctgattttggagactataatcagtttgattctcaagat
ttcctcagagagtatgtgctatttcctatggatttggccctggaagaggctgttctggag
gagctgacccagaaggtagcccaagaacacaaagcccacagtggaatcctgccagcagaa
gctgaactgatgtacatcaatgaagttgaacgtttggatggatttggacaggaaatcttc
cctgtaaaggacaatcatggaaactgtgtacaccttggcattttctttatggggattttc
gtgaggaacagaattggaagacaagcggtaatatacaggtggaatgacatggggaatatc
actcataacaagtcgaccattctagtggagctcatcaacaaagaagagactgccctcttt
cacacggatgatatcgaaaatgccaagtatatttctcggttgtttgccacacgacacaag
ttttacaaacaaaacaaaatctgcactgaacagtcaaattctccaccccccatcagacgc
cagcccacctggagccgatcctctctgcccaggcagcagccgtacatcctgcctcccgtt
cacgtccagtgtggtgagcactactcggaaacgcacacctcgcaagacagcatttttcat
gggaatgaagaagccttgtattgcaactctcacaacagcctggacttaaattatttaaat
ggcactgtcaccaatggcagcgtgtgtagcgttcacagcgtcaactccctcaactgctcg
caaagtttcatccaggcctcccctgtatcctccaacctcagtatccctgggagtgacatc
atgcgggccgactacatcccgagccaccggcacagcgcgatcatcgtgccctcgtacagg
ccaacccccgattatgagacagtcatgcgccagatgaagagggggatcctgcatacagac
agccagagccagtctctgagaaacctcaacattatcaacacccatgcctacaaccagcca
gaggatctggtgtacagccaaccggagatgcgggagaggcacccctacactgtcccttat
gggccacagggggtctacagcaacaaacttgtcagtccatctgaccagaggaacccaaag
aataatgtggtaccaagcaagccgggggcaagcgccatctcgcacacggtgagcacccca
gagctggccaacatgcagctgcagggcagccataactacagcacggcccacatgcttaag
aactatctcttcaggccaccgcccccctacccacggccacgacctgccaccagcacccca
gacctggccagccaccgccacaagtacgtcagcggcagcagcccggacctggtgacccgg
aaggtgcagctctcggtgaagaccttccaagaggacagctctccggtggttcatcagtct
ctccaggaggtgagcgagcccctcacggccaccaagcaccacggcactgtgaacaagcgc
cacagcctggaggtgatgaacagcatggtgcggggcatggaggccatgacgctcaagtcg
ctccacctccccatggctcgccgcaacacgctccgggagcagggaccgcccgaggagggg
tcaggcagccacgaggtcccccagctccctcagtatcaccacaagaagaccttctctgat
gccactatgctaatccacagcagcgagagtgaggaggaggaggaggaggctccagaatcg
gtgccccagatccccatgctccgggagaagatggagtacagtgcccagctgcaggcggcc
ctggcccgcatccccaacaagcccccgcctgagtaccccggtccaaggaagagtgtgagc
aatggggctctgaggcaggaccaagccagccttcctcccgccatggccagagccagggtg
ctgaggcatgggccagccaaggccatcagcatgtctcggactgacccgccggctgtcaac
ggggcctctctcggcccatccatctcggaacccgacctgactagtgtgaaggagcgggtc
aaaaaagagcctgtgaaggagagacctgtgtctgaaatgttttccctggaagacagcatt
atagagagagagatgatgatcaggaatctagagaagcagaagatggcaggcctggaggca
cagaagaggccgctgatgttggcagcattgaatgggctctcggtggctcgagtctcaggg
cgggaagagaatcgagttgatgccacccgggttcccatggacgagaggttcagaaccctg
aagaagaaactagaagagggaatggtgttcacagaatatgagcaaattccaaagaaaaag
gcgaatggcattttcagcacagcagctctgccagaaaacgccgagcgcagccgaatccgt
gaagttgtcccctatgaggagaatcgagtagagctgataccaaccaaagaaaataacaca
ggatacattaatgcctcccacatcaaggtggtggttggcggggcagaatggcactacata
gccacccaggggcccctgccacacacgtgccacgacttctggcagatggtgtgggagcag
ggagtgaatgtgattgccatggtcactgcagaggaggagggtggacgaaccaaaagccac
cgatactggcccaaactaggttcaaagcacagctcagccacctatggcaagttcaaggtc
accacgaagtttcgaacggattctgtttgctatgcaaccacgggcttgaaggtcaagcac
cttttgtctgggcaagaaaggacggtgtggcatttacaatatactgactggccagatcac
ggctgtccagaagatgtccaaggatttttatcctacttggaggagatccagtcggtccgt
cgccataccaacagcatgctggaaggcaccaagaaccggcacccgcccatcgtggtccac
tgtagtgctggggtgggaaggaccggcgtgctcattctttctgagctgatgatctactgc
ttggaacataacgaaaaggtggaagtgcccatgatgctgaggctcctcagggagcagagg
atgttcatgatccagactatcgctcagtacaagtttgtctaccaagtcctcatccagttc
ctccaaaactccagactcatttaa

Protein Sequence

>5784 : length: 1187
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNCVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTP
ELANMQLQGSHNYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPES
VPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARV
LRHGPAKAISMSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI



')