Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

57669

Name

EPB41L5

Synonym

BE37|YMO1;erythrocyte membrane protein band 4.1 like 5;EPB41L5;erythrocyte membrane protein band 4.1 like 5

Definition

band 4.1-like protein 5

Position

2q14.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

57669

Links to all GeneRIF Items

57669

Links to iHOP

57669

Sequence Information

Nucleotide Sequence

>57669 : length: 2064
atgctgagtttcttccgtagaacactagggcgtcggtctatgcgtaaacatgcagagaag
gaacgactccgagaagcacaacgcgccgccacacatattcctgcagctggagattctaag
tccatcatcacgtgtcgggtgtcccttctggatggtactgatgttagtgtggacttgcca
aaaaaagccaaaggacaagagttgtttgatcagattatgtaccacctggacctgattgaa
agcgactattttggtctgagatttatggattcagcacaagtagcacattggttggatggt
acaaaaagcatcaaaaagcaagtaaaaattggttcaccctattgtctgcatcttcgagtt
aagttttattcctcagaaccaaataaccttcgtgaggagctaacccggtatttatttgtt
cttcagttaaaacaagatattctcagtggaaaattagactgtccctttgatacagcagtg
caattggcagcttataatctgcaagctgaacttggtgactatgatcttgctgagcatagt
cctgaacttgtctcagagttcagattcgtgcctattcagactgaagagatggaactggct
atttttgagaaatggaaggaatacagaggtcaaacaccagcacaggctgaaaccaattat
ctgaataaagccaaatggctagaaatgtatggggttgatatgcatgtggtcaaggctaga
gatgggaatgactatagtttgggactaacaccaacaggagtccttgtttttgaaggagat
accaaaattggcttatttttttggccgaagataaccagattggattttaagaagaataaa
ttaaccttggtggttgtagaagatgatgatcagggcaaagaacaggaacatacatttgtc
tttagactggatcatccaaaagcatgcaaacatttatggaaatgtgctgtggagcatcat
gctttcttccgccttcgaggccccgtccaaaagagttctcatcgatcaggatttattcga
ctaggatcacgatttagatatagtgggaaaacagagtatcagaccacaaaaaccaataaa
gcaagaagatcaacatcctttgaaagaaggcccagcaaacgatattctagacgaactcta
caaatgaaagcatgtgctacaaaacctgaagaacttagtgttcacaataatgtttcgacc
caaagtaatggctcccaacaggcttgggggatgagatctgctctgcctgtgagtccttcc
atttcctctgctcctgtgccagtggagatagagaatcttccacagagtcctggaacagac
cagcatgacaggaaatgcattcctctgaatattgatttgctgaatagcccagacttattg
gaagcaacgattggtgatgtaattggggcatctgacactatggaaacatcccaagcactg
aatgacgttaatgtagccaccaggcttccgggattaggggaacctgaagttgaatatgag
acattaaaagacacctcagagaagctcaaacagcttgagatggagaacagtcctttgctg
tcccctcgatccaacatcgatgttaacataaacagccaggaggaagtggtgaagttgact
gagaaatgccttaataatgtcattgagagcccaggattgaatgtcatgagagttcctcct
gacttcaagagtaacattttgaaggctcaagtagaagcagtgcataaggttacaaaagaa
gatagcttattaagtcataaaaatgccaatgttcaggatgctgccacaaacagtgctgtg
ttaaatgagaataatgtgcccctccccaaagagtctcttgagactctgatgcttatcaca
cctgccgacagtggttctgttctaaaggaagctacagatgaattggatgccttgcttgca
tctctaactgagaatctaattgatcacacagttgcacctcaggtgtcttccacatccatg
atcacaccccggtggattgttccgctctggtcccattttggcagaagaagctgtcctgaa
gcagaagtgtttactgaccactga

Protein Sequence

>57669 : length: 687
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPS
ISSAPVPVEIENLPQSPGTDQHDRKCIPLNIDLLNSPDLLEATIGDVIGASDTMETSQAL
NDVNVATRLPGLGEPEVEYETLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLT
EKCLNNVIESPGLNVMRVPPDFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAV
LNENNVPLPKESLETLMLITPADSGSVLKEATDELDALLASLTENLIDHTVAPQVSSTSM
ITPRWIVPLWSHFGRRSCPEAEVFTDH



')