Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5764

Name

PTN

Synonym

HARP|HBGF8|HBNF|NEGF1;pleiotrophin;PTN;pleiotrophin

Definition

HB-GAM|HBBM|HBGF-8|HBNF-1|OSF-1|heparin affin regulatory protein|heparin binding growth factor 8|heparin-binding brain mitogen|heparin-binding growth factor 8|heparin-binding growth-associated molecule|heparin-binding neurite outgrowth-promoting factor 1|

Position

7q33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Syndecan-3-mediated signaling events;PID Curated;200170

Disease

Prostate cancer;FunDO

Disease

Nervous system tumor;FunDO

Disease

Pancreas cancer;FunDO

Disease

Brain tumor;FunDO

Disease

Breast cancer;FunDO

Disease

HIV infection;FunDO

External Links

Links to Entrez Gene

5764

Links to all GeneRIF Items

5764

Links to iHOP

5764

Sequence Information

Nucleotide Sequence

>5764 : length: 507
atgcaggctcaacagtaccagcagcagcgtcgaaaatttgcagctgccttcttggcattc
attttcatactggcagctgtggatactgctgaagcagggaagaaagagaaaccagaaaaa
aaagtgaagaagtctgactgtggagaatggcagtggagtgtgtgtgtgcccaccagtgga
gactgtgggctgggcacacgggagggcactcggactggagctgagtgcaagcaaaccatg
aagacccagagatgtaagatcccctgcaactggaagaagcaatttggcgcggagtgcaaa
taccagttccaggcctggggagaatgtgacctgaacacagccctgaagaccagaactgga
agtctgaagcgagccctgcacaatgccgaatgccagaagactgtcaccatctccaagccc
tgtggcaaactgaccaagcccaaacctcaagcagaatctaagaagaagaaaaaggaaggc
aagaaacaggagaagatgctggattaa

Protein Sequence

>5764 : length: 168
MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD



')