Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

57591

Name

MKL1

Synonym

BSAC|MAL|MRTF-A;megakaryoblastic leukemia (translocation) 1;MKL1;megakaryoblastic leukemia (translocation) 1

Definition

MKL/myocardin-like protein 1|RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein|basic, SAP and coiled-coil domain|megakaryoblastic leukemia 1 protein|megakaryocytic acute leukemia protein|myocardin-related transcription factor A

Position

22q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

RhoA signaling pathway;PID Curated;200007

Disease

Megakaryoblastic leukemia, acute;OMIM

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

External Links

Links to Entrez Gene

57591

Links to all GeneRIF Items

57591

Links to iHOP

57591

Sequence Information

Nucleotide Sequence

>57591 : length: 2796
atgccgcctttgaaaagtccagccgcatttcatgagcagagaaggagcttggagcgggcc
aggacagaggactatctcaaacggaagattcgttcccggccggagagatcggagctggtc
aggatgcacattttggaagagacctcggctgagccatccctccaggccaagcagctgaag
ctgaagagagccagactagccgatgacctcaatgagaagattgcacagaggcctggcccc
atggagctggtggagaagaacatccttcctgttgagtccagcctgaaggaagccatcatt
gtgggccaggtgaactatcccaaagtagcagacagctcttccttcgatgaggacagcagc
gatgccttatcccccgagcagcctgccagccatgagtcccagggttctgtgccgtcaccc
ctggaggcccgagtcagcgaaccactgctcagtgccacctctgcatcccccacccaggtt
gtgtctcaacttccgatgggccgggattccagagaaatgcttttcctggcagagcagcct
cctctgcctcccccacctctgctgcctcccagcctcaccaatggaaccactatccccact
gccaagtccacccccacactcattaagcaaagccaacccaagtctgccagtgagaagtca
cagcgcagcaagaaggccaaggagctgaagccaaaggtgaagaagctcaagtaccaccag
tacatccccccggaccagaagcaggacaggggggcaccccccatggactcatcctacgcc
aagatcctgcagcagcagcagctcttcctccagctgcagatcctcaaccagcagcagcag
cagcaccacaactaccaggccatcctgcctgccccgccaaagtcagcaggcgaggccctg
ggaagcagcgggacccccccagtacgcagcctctccactaccaatagcagctccagctcg
ggcgcccctgggccctgtgggctggcacgtcagaacagcacctcactgactggcaagccg
ggagccctgccggccaacctggacgacatgaaggtggcagagctgaagcaggagctgaag
ttgcgatcactgcctgtctcgggcaccaaaactgagctgattgagcgccttcgagcctat
caagaccaaatcagccctgtgccaggagcccccaaggcccctgccgccacctctatcctg
cacaaggctggcgaggtggtggtagccttcccagcggcccggctgagcacggggccagcc
ctggtggcagcaggcctggctccagctgaggtggtggtggccacggtggccagcagtggg
gtggtgaagtttggcagcacgggctccacgccccccgtgtctcccaccccctcggagcgc
tcactgctcagcacgggcgatgaaaactccacccccggggacacctttggtgagatggtg
acatcacctctgacgcagctgaccctgcaggcctcgccactgcagatcctcgtgaaggag
gagggcccccgggccgggtcctgttgcctgagccctggggggcgggcggagctagagggg
cgcgacaaggaccagatgctgcaggagaaagacaagcagatcgaggcgctgacgcgcatg
ctccggcagaagcagcagctggtggagcggctcaagctgcagctggagcaggagaagcga
gcccagcagcccgcccccgcccccgcccccctcggcacccccgtgaagcaggagaacagc
ttctccagctgccagctgagccagcagcccctgggccccgctcacccattcaaccccagc
ctggcggccccagccaccaaccacatagacccttgtgctgtggccccggggcccccgtcc
gtggtggtgaagcaggaagccttgcagcctgagcccgagccggtccccgccccccagttg
cttctggggcctcagggccccagcctcatcaagggggttgcacctcccaccctcatcacc
gactccacagggacccaccttgtcctcaccgtgaccaataagaatgcagacagccctggc
ctgtccagtgggagcccccagcagccctcgtcccagcctggctctccagcgcctgccccc
tctgcccagatggacctggagcacccactgcagcccctctttgggacccccacttctctg
ctgaagaaggaaccacctggctatgaggaagccatgagccagcagcccaaacagcaggaa
aatggttcctcaagccagcagatggacgacctgtttgacattctcattcagagcggagaa
atttcagcagatttcaaggagccgccatccctgccagggaaggagaagccatccccgaag
acagtctgtgggtcccccctggcagcacagccatcaccttctgctgagctcccccaggct
gccccacctcctccaggctcaccctccctccctggacgcctggaggacttcctggagagc
agcacggggctgcccctgctgaccagtgggcatgacgggccagagcccctttccctcatt
gacgacctccatagccagatgctgagcagcactgccatcctggaccaccccccgtcaccc
atggacacctcggaattgcactttgttcctgagcccagcagcaccatgggcctggacctg
gctgatggccacctggacagcatggactggctggagctgtcgtcaggtggtcccgtgctg
agcctagcccccctcagcaccacagcccccagcctcttctccacagacttcctcgatggc
catgatttgcagctgcactgggattcctgcttgtag

Protein Sequence

>57591 : length: 931
MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLK
LKRARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSS
DALSPEQPASHESQGSVPSPLEARVSEPLLSATSASPTQVVSQLPMGRDSREMLFLAEQP
PLPPPPLLPPSLTNGTTIPTAKSTPTLIKQSQPKSASEKSQRSKKAKELKPKVKKLKYHQ
YIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQQHHNYQAILPAPPKSAGEAL
GSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNSTSLTGKPGALPANLDDMKVAELKQELK
LRSLPVSGTKTELIERLRAYQDQISPVPGAPKAPAATSILHKAGEVVVAFPAARLSTGPA
LVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMV
TSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRM
LRQKQQLVERLKLQLEQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPS
LAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLIT
DSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSL
LKKEPPGYEEAMSQQPKQQENGSSSQQMDDLFDILIQSGEISADFKEPPSLPGKEKPSPK
TVCGSPLAAQPSPSAELPQAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHDGPEPLSLI
DDLHSQMLSSTAILDHPPSPMDTSELHFVPEPSSTMGLDLADGHLDSMDWLELSSGGPVL
SLAPLSTTAPSLFSTDFLDGHDLQLHWDSCL



')