Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

57504

Name

MTA3

Synonym

-;metastasis associated 1 family, member 3;MTA3;metastasis associated 1 family, member 3

Definition

metastasis associated family, member 3|metastasis associated gene family, member 3|metastasis-associated protein MTA3

Position

2p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

downregulated of mta-3 in er-negative breast tumors;PID BioCarta;100102

Disease

Neoplasm metastasis;FunDO

External Links

Links to Entrez Gene

57504

Links to all GeneRIF Items

57504

Links to iHOP

57504

Sequence Information

Nucleotide Sequence

>57504 : length: 1548
atggcggccaacatgtaccgggtcggagattatgtctactttgagaattcctccagcaac
ccatacctaataagaaggatagaagaactcaacaagactgcaagtggcaacgtggaagca
aaagtagtatgcttttatagacgacgtgatatttccaacacacttataatgctcgcagat
aagcatgctaaagaaattgaggaagaatctgaaacaacagttgaggctgacttgaccgat
aagcagaaacatcagttgaaacatagggaactctttttgtcacgccagtatgaatctctg
cccgcaacacatatcaggggaaagtgcagtgttgcccttctgaatgagacagaatcagta
ttgtcatatcttgataaggaggataccttcttctactcattggtctatgacccctcattg
aaaacactattagctgacaaaggtgaaatcagagtgggacctagatatcaagcagacatt
ccagaaatgctgttagaaggagaatcagatgagagggaacaatcaaaattggaagttaaa
gtttgggatccaaatagcccacttacggatcgacagattgaccagtttttagttgtagca
cgtgctgttgggacattcgccagagccctggattgcagcagttctgtgaggcagcctagt
ttgcatatgagtgctgctgcagcttcccgagacatcaccttgtttcacgctatggataca
ttgtatagacacagctatgatttgagcagtgccattagtgtcttagtaccactcggagga
cctgttttatgcagagatgaaatggaggaatggtcagcctctgaagctagcttatttgaa
gaggcactggaaaaatatggcaaagacttcaatgacatacggcaagattttcttccttgg
aaatcattgactagcatcattgaatattattacatgtggaaaactactgacagatatgtg
caacagaaacgtctaaaagcagcagaagctgagagtaaactgaaacaagtatatatccca
acctacagcaaaccaaatcccaaccaaatatccactagtaatgggaagcctggtgctgtg
aatggagctgtggggaccacgttccagcctcagaatcctctcttagggagagcctgtgag
agctgctatgctacacagtctcaccagtggtattcttggggcccacctaatatgcagtgt
agattatgtgcaatttgttggctttattggaaaaaatatggaggcttgaaaatgcccacc
cagtcagaagaagagaagttatctcctagcccaactacagaggaccctcgtgttagaagt
cacgtgtcccgccaggccatgcagggaatgccagtccgaaacactgggagtccaaagtct
gcagtgaagacccgccaagctttcttccttcatactacatatttcacaaaatttgctcgt
caggtctgcaaaaataccctccggctgcggcaggcagcaagacggccgtttgttgctatt
aattatgctgccattagggcagaatgtaagatgcttttaaattcttaa

Protein Sequence

>57504 : length: 515
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLAD
KHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESV
LSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVK
VWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDT
LYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPW
KSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAV
NGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPT
QSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFAR
QVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS



')