Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

57496

Name

MKL2

Synonym

MRTF-B|NPD001;MKL/myocardin-like 2;MKL2;MKL/myocardin-like 2

Definition

MKL/myocardin-like protein 2|megakaryoblastic leukemia 2|myocardin-related transcription factor B

Position

16p13.12

Gene Type

protein-coding

External Links

Links to Entrez Gene

57496

Links to all GeneRIF Items

57496

Links to iHOP

57496

Sequence Information

Nucleotide Sequence

>57496 : length: 3150
atggatcacacaggggcgatagacaccgaggatgaagtgggacctttagcccatcttgct
ccaagtcctcagagtgaagctgtggctcatgaattccaggaactctccttgcagtccagt
caaaacttaccccctctgaacgaaaggaaaaatgtgctccagctgaggctgcaacaaagg
aggacgagagaacaactagtggaccagggcatcatgccacctttgaagagcccagcggca
ttccatgaacagataaaaagcttggaacgagccagaactgaaaactttttgaaacacaag
attcggagtcgaccagatcgttctgaacttgtcaggatgcacattttagaagaaacattt
gcagagccatccctgcaggctactcagatgaagttgaaaagagctcgactagcagatgat
ctgaatgaaaagattgctcaaagacctggtcctatggagctggtagagaaaaacatcctt
cctgtggactccagtgttaaagaagcaattataggcgttgggaaggaggactatccccac
actcagggcgatttctcatttgatgaagacagcagtgacgctttgtctccggaccagcct
gcgagtcaggagtcacaggggtcagccgcgtccccaagtgagccaaaagttagtgaatcg
ccatctcctgtgactacaaacactccagcgcagtttgcttcagtgtccccaacagttcct
gaattcttgaaaactcctccaactgcagatcagcctcccccacggcctgcagctcctgtc
ctccccacaaacactgtgtcctcagcaaagcctggcccagcactggtgaagcaaagccat
cccaagaatccaaatgacaaacaccgtagcaaaaagtgcaaagatcccaaaccacgggta
aagaagttaaagtaccaccaatacattccaccagatcagaagggtgagaagaatgagccg
cagatggactctaactacgcccgcctgctccagcagcagcagctgttcctgcaactgcag
atcctgagtcagcagaagcagcactacaactaccagaccatcctgcctgcaccattcaag
ccactcaatgacaaaaatagtaacagtgggaattcagctttgaacaatgccacacctaac
acaccaagacagaatacatctactcctgtgagaaagccaggacctctgccttctagcctg
gatgacttaaaggtatcagaactgaagacagaactgaagttaaggggtctgccagtgtca
ggcaccaaaccggacctcattgagcgcctaaaaccctaccaggaagtgaacagcagcggc
cttgctgctgggggcatcgtggcagtgtcatcatcagccattgtcaccagtaacccagaa
gtcactgtggccttgccggttacaacactacacaacactgtgactagctcagtctctact
ctcaaggcagaattgccacctacaggaaccagcaacgcaacccgtgtggaaaatgttcat
tcccctctgcccatttcaccatctccctccgaacagtccagtctcagtactgatgacaca
aacatggcagacactttcaccgagattatgaccatgatgtcgccttcacagttcttgagt
tcatctcctttgagaatgacaaataatgaagacagtctgagtcccaccagcagcactctg
tcaaacctggaactggatgcagccgaaaaggatcgcaagcttcaggagaaagagaagcaa
atcgaagagctgaagaggaaactggaacaagagcagaagctcgtggaagtgctgaaaatg
caacttgaggttgaaaaacgagggcagcagcagcggcccctggaagcccagcccagtgcc
ccaggtcattctgtcaagtcagatcagaagcacggcagccttggctcctccatcaaagat
gaggcctcactccctgactgctccagctccaggcagcccatcccagtagccagccacgct
gtaggccagcccgtctctacaggtggccagacccttgttgccaaaaaggctgtagttatc
aagcaagaggtccctgtgggccaggcagagcagcagagtgtcgtctcgcagttttatact
tcaccacaagcaggaatgcagactcagcctcagatagcaactgctgcacaaataccaact
gctgccttggcctcaggcttggccccaactgtacctcagacacaagacacgttcccgcag
catgtgctcagtcagcctcaacaagtcagaaaggttttcacaaactcagcatcatcaaat
acagttcttccatatcagagacatcctgccccagctgtccagcagccctttatcaataag
gcctccaacagtgttcttcaatccagaaatgctccgcttccatccctgcaaaatggacct
aacacacccaacaagcctagttcacccccgccaccccagcaatttgtcgtccagcactct
ctatttgggagtccagtcgccaagacaaaagatcccccccgctatgaggaggccatcaag
cagacacgcagcacacaggcccctctgccagagatttccaacgctcacagtcagcagatg
gatgacctctttgatatcctcattaagagtggagagatctccctccccataaaagaagaa
ccttctcctatttccaaaatgagaccagtgacagccagcatcaccacaatgccagtgaat
acagtggtgtcccggccaccaccccaagtccaaatggcaccacctgtatctttagaacct
atgggcagtttatctgccagcttagagaaccaactagaagctttcttggatggaacttta
ccctcagccaatgaaattcctccactacaaagcagcagtgaagacagagagcccttctct
ctgatcgaggacctccagaatgatctgctgagtcactcaggtatgctggaccattcacac
tcacccatggagacttccgagacccagtttgctgcaggtactccctgtctgtctctcgac
ctgtcagactcaaacttggacaacatggagtggttggacattaccatgcccaactcctct
tcaggactcactcctctcagcaccaccgcgccgagcatgttctctgctgactttctagac
ccacaggacctaccgctgccatgggactaa

Protein Sequence

>57496 : length: 1049
MDHTGAIDTEDEVGPLAHLAPSPQSEAVAHEFQELSLQSSQNLPPLNERKNVLQLRLQQR
RTREQLVDQGIMPPLKSPAAFHEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETF
AEPSLQATQMKLKRARLADDLNEKIAQRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPH
TQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVP
EFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSKKCKDPKPRV
KKLKYHQYIPPDQKGEKNEPQMDSNYARLLQQQQLFLQLQILSQQKQHYNYQTILPAPFK
PLNDKNSNSGNSALNNATPNTPRQNTSTPVRKPGPLPSSLDDLKVSELKTELKLRGLPVS
GTKPDLIERLKPYQEVNSSGLAAGGIVAVSSSAIVTSNPEVTVALPVTTLHNTVTSSVST
LKAELPPTGTSNATRVENVHSPLPISPSPSEQSSLSTDDTNMADTFTEIMTMMSPSQFLS
SSPLRMTNNEDSLSPTSSTLSNLELDAAEKDRKLQEKEKQIEELKRKLEQEQKLVEVLKM
QLEVEKRGQQQRPLEAQPSAPGHSVKSDQKHGSLGSSIKDEASLPDCSSSRQPIPVASHA
VGQPVSTGGQTLVAKKAVVIKQEVPVGQAEQQSVVSQFYTSPQAGMQTQPQIATAAQIPT
AALASGLAPTVPQTQDTFPQHVLSQPQQVRKVFTNSASSNTVLPYQRHPAPAVQQPFINK
ASNSVLQSRNAPLPSLQNGPNTPNKPSSPPPPQQFVVQHSLFGSPVAKTKDPPRYEEAIK
QTRSTQAPLPEISNAHSQQMDDLFDILIKSGEISLPIKEEPSPISKMRPVTASITTMPVN
TVVSRPPPQVQMAPPVSLEPMGSLSASLENQLEAFLDGTLPSANEIPPLQSSSEDREPFS
LIEDLQNDLLSHSGMLDHSHSPMETSETQFAAGTPCLSLDLSDSNLDNMEWLDITMPNSS
SGLTPLSTTAPSMFSADFLDPQDLPLPWD



')