Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5747

Name

PTK2

Synonym

FADK|FAK|FAK1|FRNK|PPP1R71|pp125FAK;PTK2 protein tyrosine kinase 2;PTK2;PTK2 protein tyrosine kinase 2

Definition

FADK 1|FAK-related non-kinase polypeptide|focal adhesion kinase 1|protein phosphatase 1, regulatory subunit 71

Position

8q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Apoptotic cleavage of cellular proteins;PID Reactome;500270

Pathway

p130Cas linkage to MAPK signaling for integrins;PID Reactome;500007

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

DCC mediated attractive signaling;PID Reactome;500089

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

cell to cell adhesion signaling;PID BioCarta;100208

Pathway

Grb2:SOS provides linkage to MAPK signaling for Intergrins;PID Reactome;500006

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

IGF1 pathway;PID Curated;200084

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

NCAM signaling for neurite out-growth;PID Reactome;500079

Pathway

Hemostasis;Reactome;REACT:604

Pathway

ccr3 signaling in eosinophils;PID BioCarta;100215

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

mcalpain and friends in cell motility;PID BioCarta;100111

Pathway

Internalization of ErbB1;PID Curated;200146

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

Integrin alphaIIbbeta3 signaling;PID Reactome;500005

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Lupus erythematosus;FunDO

Disease

Wiskott-Aldrich syndrome;FunDO

Disease

Primary hyperparathyroidism;FunDO

Disease

Adenovirus infection;FunDO

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

hepatocellular carcinoma;GAD

Disease

Kidney disease;FunDO

External Links

Links to Entrez Gene

5747

Links to all GeneRIF Items

5747

Links to iHOP

5747

Sequence Information

Nucleotide Sequence

>5747 : length: 3198
atggcagctgcttaccttgaccccaacttgaatcacacaccaaattcgagtactaagact
cacctgggtactggtatggaacgttctcctggtgcaatggagcgagtattaaaggtcttt
cattattttgaaagcaatagtgagccaaccacctgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcatgtg
gcctgctatggattccgcctcagtcacctgcggtcagaggaggttcactggcttcacgtg
gatatgggcgtctccagtgtgagggagaagtatgagcttgctcacccaccagaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagat
aagccaactttgaatttcttctatcaacaggtgaagagcgattatatgttagagatagct
gatcaagtggaccaggaaattgctttgaagttgggttgtctagaaatacggcgatcatac
tgggagatgcggggcaatgcactagaaaagaagtctaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaaactgatccaacaaacatttagacaatttgccaaccttaatagagaagaaagtatt
ctgaaattctttgagatcctgtctccagtctacagatttgataaggaatgcttcaagtgt
gctcttggttcaagctggattatttcagtggaactggcaatcggcccagaagaaggaatc
agttacctaacggacaagggctgcaatcccacacatcttgctgacttcactcaagtgcaa
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacaactaaaaata
gcaggtgcacccgagcctctgacagtgacggcaccatccctaaccattgcggagaatatg
gctgacctaatagatgggtactgccggctggtgaatggaacctcgcagtcatttatcatc
agacctcagaaagaaggtgaacgggctttgccatcaataccaaagttggccaacagcgaa
aagcaaggcatgcggacacacgccgtctctgtgtcagaaacagatgattatgctgagatt
atagatgaagaagatacttacaccatgccctcaaccagggattatgagattcaaagagaa
agaatagaacttggacgatgtattggagaaggccaatttggagatgtacatcaaggcatt
tatatgagtccagagaatccagctttggcggttgcaattaaaacatgtaaaaactgtact
tcggacagcgtgagagagaaatttcttcaagaagccttaacaatgcgtcagtttgaccat
cctcatattgtgaagctgattggagtcatcacagagaatcctgtctggataatcatggag
ctgtgcacacttggagagctgaggtcatttttgcaagtaaggaaatacagtttggatcta
gcatctttgatcctgtatgcctatcagcttagtacagctcttgcatatctagagagcaaa
agatttgtacacagggacattgctgctcggaatgttctggtgtcctcaaatgattgtgta
aaattaggagactttggattatcccgatatatggaagatagtacttactacaaagcttcc
aaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtatggatgtttggtgtgtgtatgtgggagatactgatgcatggtgtg
aagccttttcaaggagtgaagaacaatgatgtaatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgggcc
tatgaccccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatcctg
gaggaagagaaggctcagcaagaagagcgcatgaggatggagtccagaagacaggccaca
gtgtcctgggactccggagggtctgatgaagcaccgcccaagcccagcagaccgggttat
cccagtccgaggtccagcgaaggattttatcccagcccacagcacatggtacaaaccaat
cattaccaggtttctggctaccctggttcacatggaatcacagccatggctggcagcatc
tatccaggtcaggcatctcttttggaccaaacagattcatggaatcatagacctcaggag
atagcaatgtggcagcccaatgtggaggactctacagtattggacctgcgagggattggg
caagtgttgccaacccatctgatggaagagcgtctaatccgacagcaacaggaaatggaa
gaagatcagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactctct
cgaggcagtattgacagggaggatggaagtcttcagggtccgattggaaaccaacatata
tatcagcctgtgggtaaaccaggtaaagaagaaaagaattgggcggaaagaaatcctgca
gctccaccaaagaaaccgcctcgccctggagctcccggtcatctgggaagccttgccagc
ctcagcagccctgctgacagctacaacgagggtgtcaagccatggaggcttcagccccag
gaaatcagcccccctcctactgccaacctggaccggtcgaatgataaggtgtacgagaat
gtgacgggcctggtgaaagctgtcatcgagatgtccagtaaaatccagccagccccacca
gaggagtatgtccctatggtgaaggaagtcggcttggccctgaggacattattggccact
gtggatgagaccattcccctcctaccagccagcacccaccgagagattgagatggcacag
aagctattgaactctgacctgggtgagctcatcaacaagatgaaactggcccagcagtat
gtcatgaccagcctccagcaagagtacaaaaagcaaatgctgactgctgctcacgccctg
gctgtggatgccaaaaacttactcgatgtcattgaccaagcaagactgaaaatgcttggg
cagacgagaccacactga

Protein Sequence

>5747 : length: 1065
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPGKEEKNWAERNPAAPPKKPPRPGAPGHLGSLAS
LSSPADSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPP
EEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQY
VMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH



')