Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5744

Name

PTHLH

Synonym

BDE2|HHM|PLP|PTHR|PTHRP;parathyroid hormone-like hormone;PTHLH;parathyroid hormone-like hormone

Definition

PTH-rP|PTH-related protein|osteostatin|parathyroid hormone-like related protein|parathyroid hormone-related protein

Position

12p12.1-p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Signaling by GPCR;Reactome;REACT:14797

Disease

Humoral hypercalcemia of malignancy;OMIM

Disease

Heart failure;FunDO

Disease

Cancer;FunDO

Disease

Brachydactyly, type E2;OMIM

External Links

Links to Entrez Gene

5744

Links to all GeneRIF Items

5744

Links to iHOP

5744

Sequence Information

Nucleotide Sequence

>5744 : length: 528
atgcagcggagactggttcagcagtggagcgtcgcggtgttcctgctgagctacgcggtg
ccctcctgcgggcgctcggtggagggtctcagccgccgcctcaaaagagctgtgtctgaa
catcagctcctccatgacaaggggaagtccatccaagatttacggcgacgattcttcctt
caccatctgatcgcagaaatccacacagctgaaatcagagctacctcggaggtgtcccct
aactccaagccctctcccaacacaaagaaccaccccgtccgatttgggtctgatgatgag
ggcagatacctaactcaggaaactaacaaggtggagacgtacaaagagcagccgctcaag
acacctgggaagaaaaagaaaggcaagcccgggaaacgcaaggagcaggaaaagaaaaaa
cggcgaactcgctctgcctggttagactctggagtgactgggagtgggctagaaggggac
cacctgtctgacacctccacaacgtcgctggagctcgattcacggtaa

Protein Sequence

>5744 : length: 175
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR



')