Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5743

Name

PTGS2

Synonym

COX-2|COX2|GRIPGHS|PGG/HS|PGHS-2|PHS-2|hCox-2;prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase);PTGS2;prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)

Definition

PGH synthase 2|PHS II|cyclooxygenase 2b|prostaglandin G/H synthase 2|prostaglandin H2 synthase 2

Position

1q25.2-q25.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

S1P1 pathway;PID Curated;200071

Pathway

Hormone biosynthesis;Reactome;REACT:15314

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

COX reactions;PID Reactome;500205

Pathway

Prostanoid metabolism;PID Reactome;500770

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Biological oxidations;Reactome;REACT:13433

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

prostanoid biosynthesis;BioCyc;PWY66-374

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Arachidonic acid metabolism;KEGG PATHWAY;hsa00590

Disease

Ischemia;FunDO

Disease

Cholangiocarcinoma;KEGG DISEASE;H00046

Disease

Alzheimer's disease;GAD

Disease

Periodontitis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

Asthma;FunDO

Disease

Cancer;FunDO

Disease

Polyarthritis;FunDO

Disease

Oral cancer;FunDO

Disease

bladder cancer;GAD

Disease

Sickle cell disease;FunDO

Disease

Parkinson disease;FunDO

Disease

Esophageal Neoplasms;GAD

Disease

stroke, atherothrombotic;GAD

Disease

Chronic fatigue syndrome;FunDO

Disease

lung cancer;GAD

Disease

cervical cancer;GAD

Disease

IMMUNE;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

cardiovascular disease;GAD

Disease

prostate cancer;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

Dental plaque;FunDO

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Stroke;FunDO

Disease

Alzheimer's disease;FunDO

Disease

colorectal cancer;GAD

Disease

METABOLIC;GAD

Disease

diabetes, type 2;GAD

Disease

placental malperfusion pregnancy complications;GAD

Disease

Knee osteoarthritis;NHGRI

Disease

REPRODUCTION;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

Vulvar disease;FunDO

Disease

Myocardial Infarction;GAD

Disease

analgesic response;GAD

Disease

Endometriosis;FunDO

Disease

Prion disease;FunDO

Disease

skin cancer, non-melanoma;GAD

Disease

Growth retardation;FunDO

Disease

Cancers;KEGG DISEASE

Disease

knee osteoarthritis;GAD

Disease

Gouts;FunDO

Disease

colon cancer;GAD

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

breast cancer;GAD

Disease

CANCER;GAD

Disease

sarcoidosis;GAD

Disease

stomach cancer;GAD

Disease

Metaplastic polyp;FunDO

Disease

Thyroid gland disease;FunDO

Disease

Carcinoma, Squamous Cell;GAD

Disease

myocardial infarct;GAD

Disease

Esophageal cancer;KEGG DISEASE;H00017

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

5743

Links to all GeneRIF Items

5743

Links to iHOP

5743

Sequence Information

Nucleotide Sequence

>5743 : length: 1815
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatacagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttttg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcct
gtgcctgatgattgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaattgcttctaagaagaaagttcatccctgatccccagggctca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaacgggctgggccatggggtggacttaaatcatatttac
ggtgaaactctggctagacagcgtaaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgaatttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatattg
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacagaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcggcca
gatgccatctttggtgaaaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcattaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

Protein Sequence

>5743 : length: 604
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL



')