Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

57057

Name

TBX20

Synonym

ASD4;T-box 20;TBX20;T-box 20

Definition

T-box protein 20|T-box transcription factor TBX20

Position

7p14.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

57057

Links to all GeneRIF Items

57057

Links to iHOP

57057

Sequence Information

Nucleotide Sequence

>57057 : length: 1344
atggagttcacggcgtcccccaagccccaactctcctctcgggccaacgccttctccatt
gccgcgctcatgtcgagcggcggctctaaggagaaggaggcgacggagaacacaatcaaa
cccctggagcaatttgtggagaagtcgtcctgtgcccagcccctgggtgagctgaccagc
ctggatgctcatggggagtttggtggaggcagtggcagcagcccgtcctcctcctctctg
tgcactgagccactgatccccaccacccccatcatccccagtgaggaaatggccaaaatt
gcctgcagcctggagaccaaggagctttgggacaaattccatgagctgggcaccgagatg
atcatcaccaagtcgggcaggaggatgtttccaaccatccgggtgtccttttcgggggtg
gatcctgaggccaagtacatagtcctgatggacatcgtccctgtggacaacaagaggtac
cgctacgcctaccaccggtcctcctggctggtggctggcaaggccgacccgccgttgcca
gccaggctctatgtgcatccagattctccttttaccggtgagcaactactcaaacagatg
gtgtcttttgaaaaggtgaaactcaccaacaatgaactggatcaacatggccatataatt
ttgaactcaatgcataagtaccagccaagggtgcacatcattaagaagaaagaccacaca
gcctcattgctcaacctgaagtctgaagaatttagaactttcatctttccagaaacagtt
tttacggcagtcactgcctaccagaatcaactgataacgaagctgaaaatagatagcaat
ccttttgccaaaggattccgggattcctccaggctcactgacattgagagggaaagtgtg
gagagcctgattcaaaagcattcctatgcacgctcacccatccgtacctacggaggagaa
gaagatgtcttgggggatgagagtcagacaaccccaaatcgagggtcagcctttacaaca
tctgataatttgtctctcagctcctgggtatcatcttcttccagttttcctgggtttcag
cacccacagtccctgactgctcttggcaccagcacagcatccatagcaacacccattcct
caccccatccagggttctctgccaccatatagccgactgggaatgcctctgacaccatcg
gccattgccagctccatgcaagggagtggccccacattcccttcattccacatgccgcga
taccatcactattttcagcaggggccctatgctgccattcaaggactacgccattcctct
gctgtgatgacgccatttgtatga

Protein Sequence

>57057 : length: 447
MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTS
LDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEM
IITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLP
ARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHT
ASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESV
ESLIQKHSYARSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSLSSWVSSSSSFPGFQ
HPQSLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPR
YHHYFQQGPYAAIQGLRHSSAVMTPFV



')