Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

56998

Name

CTNNBIP1

Synonym

ICAT;catenin, beta interacting protein 1;CTNNBIP1;catenin, beta interacting protein 1

Definition

beta-catenin-interacting protein 1|beta-catenin-interacting protein ICAT|inhibitor of beta-catenin and Tcf-4

Position

1p36.22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

56998

Links to all GeneRIF Items

56998

Links to iHOP

56998

Sequence Information

Nucleotide Sequence

>56998 : length: 246
atgaaccgcgagggagctcccgggaagagtccggaggagatgtacattcagcagaaggtc
cgagtgctgctcatgctgcggaagatgggatcaaacctgacagccagcgaggaggagttc
ctgcgcacctatgcaggggtggtcaacagccagctcagccagctgcctccgcactccatc
gaccagggtgcagaggacgtggtgatggcgttttccaggtcggagacggaagaccggagg
cagtag

Protein Sequence

>56998 : length: 81
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ



')