Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

56649

Name

TMPRSS4

Synonym

CAPH2|MT-SP2|TMPRSS3;transmembrane protease, serine 4;TMPRSS4;transmembrane protease, serine 4

Definition

channel-activating protease 2|membrane-type serine protease 2|transmembrane protease serine 4|transmembrane serine protease 3|type II membrane serine protease

Position

11q23.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

56649

Links to all GeneRIF Items

56649

Links to iHOP

56649

Sequence Information

Nucleotide Sequence

>56649 : length: 1299
atgttacaggatcctgacagtgatcaacctctgaacagcctcgatgtcaaacccctgcgc
aaaccccgtatccccatggagaccttcagaaaggtggggatccccatcatcatagcacta
ctgagcctggcgagtatcatcattgtggttgtcctcatcaaggtgattctggataaatac
tacttcctctgcgggcagcctctccacttcatcccgaggaagcagctgtgtgacggagag
ctggactgtcccttgggggaggacgaggagcactgtgtcaagagcttccccgaagggcct
gcagtggcagtccgcctctccaaggaccgatccacactgcaggtgctggactcggccaca
gggaactggttctctgcctgtttcgacaacttcacagaagctctcgctgagacagcctgt
aggcagatgggctacagcagagctgtggagattggcccagaccaggatctggatgttgtt
gaaatcacagaaaacagccaggagcttcgcatgcggaactcaagtgggccctgtctctca
ggctccctggtctccctgcactgtcttgcctgtgggaagagcctgaagaccccccgtgtg
gtgggtggggaggaggcctctgtggattcttggccttggcaggtcagcatccagtacgac
aaacagcacgtctgtggagggagcatcctggacccccactgggtcctcacggcagcccac
tgcttcaggaaacataccgatgtgttcaactggaaggtgcgggcaggctcagacaaactg
ggcagcttcccatccctggctgtggccaagatcatcatcattgaattcaaccccatgtac
cccaaagacaatgacatcgccctcatgaagctgcagttcccactcactttctcaggcaca
gtcaggcccatctgtctgcccttctttgatgaggagctcactccagccaccccactctgg
atcattggatggggctttacgaagcagaatggagggaagatgtctgacatactgctgcag
gcgtcagtccaggtcattgacagcacacggtgcaatgcagacgatgcgtaccagggggaa
gtcaccgagaagatgatgtgtgcaggcatcccggaagggggtgtggacacctgccagggt
gacagtggtgggcccctgatgtaccaatctgaccagtggcatgtggtgggcatcgttagt
tggggctatggctgcgggggcccgagcaccccaggagtatacaccaaggtctcagcctat
ctcaactggatctacaatgtctggaaggctgagctgtaa

Protein Sequence

>56649 : length: 432
MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKY
YFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT
GNWFSACFDNFTEALAETACRQMGYSRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLS
GSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAH
CFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGT
VRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGE
VTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAY
LNWIYNVWKAEL



')