Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

56648

Name

EIF5A2

Synonym

EIF-5A2|eIF5AII;eukaryotic translation initiation factor 5A2;EIF5A2;eukaryotic translation initiation factor 5A2

Definition

eIF-5A-2|eukaryotic initiation factor 5A|eukaryotic translation initiation factor 5A-2

Position

3q26.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolism of proteins;Reactome;REACT:17015

Disease

Infertility;FunDO

Disease

Ovarian cancer;FunDO

External Links

Links to Entrez Gene

56648

Links to all GeneRIF Items

56648

Links to iHOP

56648

Sequence Information

Nucleotide Sequence

>56648 : length: 462
atggcagacgaaattgatttcactactggagatgccggggcttccagcacttaccctatg
cagtgctcggccttgcgcaaaaacggcttcgtggtgctcaaaggacgaccatgcaaaata
gtggagatgtcaacttccaaaactggaaagcatggtcatgccaaggttcaccttgttgga
attgatattttcacgggcaaaaaatatgaagatatttgtccttctactcacaacatggat
gttccaaatattaagagaaatgattatcaactgatatgcattcaagatggttacctttcc
ctgctgacagaaactggtgaagttcgtgaggatcttaaactgccagaaggtgaactaggc
aaagaaatagagggaaaatacaatgcaggtgaagatgtacaggtgtctgtcatgtgtgca
atgagtgaagaatatgctgtagccataaaaccctgcaaataa

Protein Sequence

>56648 : length: 153
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELG
KEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK



')