Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5653

Name

KLK6

Synonym

Bssp|Klk7|PRSS18|PRSS9|SP59|hK6;kallikrein-related peptidase 6;KLK6;kallikrein-related peptidase 6

Definition

kallikrein-6|neurosin|protease M|serine protease 18|serine protease 9|zyme

Position

19q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Alpha-synuclein signaling;PID Curated;200187

External Links

Links to Entrez Gene

5653

Links to all GeneRIF Items

5653

Links to iHOP

5653

Sequence Information

Nucleotide Sequence

>5653 : length: 735
atgaagaagctgatggtggtgctgagtctgattgctgcagcctgggcagaggagcagaat
aagttggtgcatggcggaccctgcgacaagacatctcacccctaccaagctgccctctac
acctcgggccacttgctctgtggtggggtccttatccatccactgtgggtcctcacagct
gcccactgcaaaaaaccgaatcttcaggtcttcctggggaagcataaccttcggcaaagg
gagagttcccaggagcagagttctgttgtccgggctgtgatccaccctgactatgatgcc
gccagccatgaccaggacatcatgctgttgcgcctggcacgcccagccaaactctctgaa
ctcatccagccccttcccctggagagggactgctcagccaacaccaccagctgccacatc
ctgggctggggcaagacagcagatggtgatttccctgacaccatccagtgtgcatacatc
cacctggtgtcccgtgaggagtgtgagcatgcctaccctggccagatcacccagaacatg
ttgtgtgctggggatgagaagtacgggaaggattcctgccagggtgattctgggggtccg
ctggtatgtggagaccacctccgaggccttgtgtcatggggtaacatcccctgtggatca
aaggagaagccaggagtctacaccaacgtctgcagatacacgaactggatccaaaaaacc
attcaggccaagtga

Protein Sequence

>5653 : length: 244
MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTA
AHCKKPNLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSE
LIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNM
LCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKT
IQAK



')