Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5652

Name

PRSS8

Synonym

CAP1|PROSTASIN;protease, serine, 8;PRSS8;protease, serine, 8

Definition

channel-activating protease 1|prostasin|serine protease 8

Position

16p11.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

5652

Links to all GeneRIF Items

5652

Links to iHOP

5652

Sequence Information

Nucleotide Sequence

>5652 : length: 1032
atggcccagaagggggtcctggggcctgggcagctgggggctgtggccattctgctctat
cttggattactccggtcggggacaggagcggaaggggcagaagctccctgcggtgtggcc
ccccaagcacgcatcacaggtggcagcagtgcagtcgccggtcagtggccctggcaggtc
agcatcacctatgaaggcgtccatgtgtgtggtggctctctcgtgtctgagcagtgggtg
ctgtcagctgctcactgcttccccagcgagcaccacaaggaagcctatgaggtcaagctg
ggggcccaccagctagactcctactccgaggacgccaaggtcagcaccctgaaggacatc
atcccccaccccagctacctccaggagggctcccagggcgacattgcactcctccaactc
agcagacccatcaccttctcccgctacatccggcccatctgcctccctgcagccaacgcc
tccttccccaacggcctccactgcactgtcactggctggggtcatgtggccccctcagtg
agcctcctgacgcccaagccactgcagcaactcgaggtgcctctgatcagtcgtgagacg
tgtaactgcctgtacaacatcgacgccaagcctgaggagccgcactttgtccaagaggac
atggtgtgtgctggctatgtggaggggggcaaggacgcctgccagggtgactctgggggc
ccactctcctgccctgtggagggtctctggtacctgacgggcattgtgagctggggagat
gcctgtggggcccgcaacaggcctggtgtgtacactctggcctccagctatgcctcctgg
atccaaagcaaggtgacagaactccagcctcgtgtggtgccccaaacccaggagtcccag
cccgacagcaacctctgtggcagccacctggccttcagctctgccccagcccagggcttg
ctgaggcccatccttttcctgcctctgggcctggctctgggcctcctctccccatggctc
agcgagcactga

Protein Sequence

>5652 : length: 343
MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQV
SITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDI
IPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSV
SLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGG
PLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQ
PDSNLCGSHLAFSSAPAQGLLRPILFLPLGLALGLLSPWLSEH



')