Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

56288

Name

PARD3

Synonym

ASIP|Baz|Bazooka|PAR3|PAR3alpha|PARD3A|SE2-5L16|SE2-5LT1|SE2-5T2;par-3 partitioning defective 3 homolog (C. elegans);PARD3;par-3 partitioning defective 3 homolog (C. elegans)

Definition

CTCL tumor antigen se2-5|PAR3-alpha|PARD-3|atypical PKC isotype-specific interacting protein|atypical PKC isotype-specific-interacting protein|partitioning defective 3 homolog

Position

10p11.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Disease

Acute lymphoblastic leukemia (childhood);NHGRI

Disease

CANCER;GAD

Disease

Acute lymphoblastic leukemia (childhood);GAD

Disease

Emphysema-related traits;NHGRI

External Links

Links to Entrez Gene

56288

Links to all GeneRIF Items

56288

Links to iHOP

56288

Sequence Information

Nucleotide Sequence

>56288 : length: 4062
atgaaagtgaccgtgtgcttcggacggacccgggtggtcgtgccgtgcggggacggccac
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccatcgccaag
gatccaaactactggatacaggtgcatcgcttggaacatggagatggaggaatactagac
cttgatgacattctttgtgatgtagcagacgataaagacagactggtagcagtgtttgat
gagcaggatccacatcacggaggtgatggcaccagtgccagttccacgggtacccagagc
ccagagatatttggtagtgagcttggcaccaacaatgtctcagcctttcagccttaccaa
gcaacaagtgaaattgaggtcacaccttcagtccttcgagcaaatatgcctcttcatgtt
cgacgcagtagtgacccagctctaattggcctctccacttctgtcagtgatagtaatttt
tcctctgaagagccttcaaggaaaaatcccacacgctggtcaacaacagctggcttcctc
aagcagaacactgctgggagtcctaaaacctgcgacaggaagaaagatgaaaactacaga
agcctcccgcgggatactagtaactggtctaaccaatttcagagagacaatgctcgctcg
tctctgagtgccagtcacccaatggtgggcaagtggctggagaaacaagaacaggatgag
gatgggacagaagaggataacagtcgtgttgaacctgttggacatgctgacacgggtttg
gagcatatacccaacttttctctggatgatatggtaaagctcgtagaagtccccaacgat
ggagggcctctgggaatccatgtagtgcctttcagtgctcgaggcggcagaaccctgggg
ttattagtaaaacgattggagaaaggtggtaaagctgaacatgaaaatctttttcgtgag
aatgattgcattgtcaggattaatgatggcgaccttcgaaatagaagatttgaacaagca
caacatatgtttcgccaagccatgcgtacacccatcatttggttccatgtggttcctgca
gcaaataaagagcagtatgaacaactatcccaaagtgagaagaacaattactattcaagc
cgttttagccctgacagccagtatattgacaacaggagtgtgaacagtgcagggcttcac
acggtgcagagagcaccccgactgaaccacccgcctgagcagatagactctcactcaaga
ctacctcatagcgcacacccctcgggaaaaccaccatccgctccagcctcggcacctcag
aatgtatttagtacgactgtaagcagtggttataacaccaaaaaaataggcaagaggctt
aatatccagcttaagaaaggtacagaaggtttgggattcagcatcacttccagagatgta
acaataggtggctcagctccaatctatgtgaaaaacattctcccccggggggcggccatt
caggatggccgacttaaggcaggagacagacttatagaggtaaatggagtagatttagtg
ggcaaatcccaagaggaagttgtttcgctgttgagaagcaccaagatggaaggaactgtg
agccttctggtctttcgccaggaagacgccttccacccaagggaactgaatgcagagcca
agccagatgcagattccaaaagaaacgaaagcagaagatgaggatattgttcttacacct
gatggcaccagggaatttctgacatttgaagtcccacttaatgattcaggatctgcaggc
cttggtgtcagtgtcaaaggtaaccggtcaaaagagaaccacgcagatttgggaatcttt
gtcaagtccattattaatggaggagcagcatctaaagatggaaggcttcgggtgaatgat
caactgatagcagtaaatggagaatccctgttgggcaagacaaaccaagatgccatggaa
accctaagaaggtctatgtctactgaaggcaataaacgaggaatgatccagcttattgtt
gcaaggagaataagcaagtgcaatgagctgaagtcacctgggagcccccctggacctgag
ctgcccattgaaacagcgttggatgatagagaacgaagaatttcccattccctctacagt
gggattgaggggcttgatgaatcgcccagcagaaatgctgccctcagtaggataatgggt
aaataccagctgtcccctacagtgaatatgccccaagatgacactgtcattatagaagat
gacaggttgccagtgcttcctccacatctctctgaccagtcctcttccagctcccatgat
gatgtggggtttgtgacggcagatgctggtacttgggccaaggctgcaatcagtgattca
gccgactgctctttgagtccagatgttgatccagttcttgcttttcaacgagaaggattt
ggacgtcagagtatgtcagaaaaacgcacaaagcaattttcagatgccagtcaattggat
ttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgagactaaactc
aatacagtggatgaccagaaagcaggttctcccagcagagatgtgggtccttccctgggt
ctgaagaagtcaagctcgttggagagtctgcagaccgcagttgccgaggtgactttgaat
ggggatattcctttccatcgtccacggccgcggataatcagaggcaggggatgcaatgag
agcttcagagctgccatcgacaaatcttatgataaacccgcggtagatgatgatgatgaa
ggcatggagaccttggaagaagacacagaagaaagttcaagatcagggagagagtctgta
tccacagccagtgatcagccttcccactctctggagagacaaatgaatggaaaccaagag
aaaggtgataagactgatagaaaaaaggataaaactggaaaagaaaagaagaaagataga
gataaggagaaggataaaatgaaagccaagaagggaatgctgaagggcttgggagacatg
ttcaggtttggcaaacatcgaaaagatgacaagattgagaaaacgggtaaaataaaaata
caggaatcctttacatcagaagaggagaggatacgaatgaagcaggagcaggagaggatt
caagccaaaactcgagaatttagggaacgacaagctcgagagcgtgactatgctgaaatt
caagattttcatcggacatttggctgtgatgatgagttaatgtatgggggagtttcttct
tatgaaggttccatggctctcaacgctagacctcagagcccacgagaagggcatatgatg
gatgctttgtatgcccaagtcaagaagccgcggaattccaaaccctcacctgtagacagt
aacagatcaactcctagcaatcatgatcggatacagcgtctgaggcaagaatttcagcaa
gcaaagcaagatgaagatgtagaagatcgtcggcggacctatagttttgagcaaccctgg
ccgaacgcacggccggcgacgcagagcgggcgacactcggtgtccgtggaggtgcagatg
cagcggcagcggcaggaggagcgcgagagctcccagcaggcccagcgccagtacagctct
ctgcctcggcaaagcaggaaaaatgccagctcggtctcccaggactcttgggagcagaac
tactcccctggggaaggcttccagagtgccaaagagaaccccaggtactccagctaccaa
ggctccaggaacggctacctgggaggacatggcttcaacgccagggtcatgctggaaact
caggagctccttcgccaggaacagaggcggaaggagcagcagatgaagaagcagcctcct
tccgaggggcccagcaactatgactcgtataagaaagtccaggaccccagttacgcccct
cccaaggggcccttccggcaagatgtgcccccctccccttctcaggttgcgaggctgaac
agacttcagactcctgagaaagggaggcccttctattcctga

Protein Sequence

>56288 : length: 1353
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSSSHD
DVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLD
FVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLN
GDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESV
STASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDM
FRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEI
QDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDS
NRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVEVQM
QRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYSSYQ
GSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAP
PKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS



')