Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5599

Name

MAPK8

Synonym

JNK|JNK-46|JNK1|JNK1A2|JNK21B1/2|PRKM8|SAPK1|SAPK1c;mitogen-activated protein kinase 8;MAPK8;mitogen-activated protein kinase 8

Definition

JUN N-terminal kinase|MAP kinase 8|c-Jun N-terminal kinase 1|mitogen-activated protein kinase 8 isoform JNK1 alpha1|mitogen-activated protein kinase 8 isoform JNK1 beta2|stress-activated protein kinase 1|stress-activated protein kinase 1c

Position

10q11.22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

egf signaling pathway;PID BioCarta;100181

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

atm signaling pathway;PID BioCarta;100235

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

fas signaling pathway (cd95);PID BioCarta;100167

Pathway

Endothelins;PID Curated;200004

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

toll-like receptor pathway;PID BioCarta;100013

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Glypican 3 network;PID Curated;200193

Pathway

Activation of BMF and translocation to mitochondria;PID Reactome;500263

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Nephrin/Neph1 signaling in the kidney podocyte;PID Curated;200132

Pathway

TRAIL signaling pathway;PID Curated;200056

Pathway

Interferon-gamma signaling pathway;PANTHER;P00035

Pathway

IL12 signaling mediated by STAT4;PID Curated;200197

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

NRIF signals cell death from the nucleus;PID Reactome;500610

Pathway

JNK signaling in the CD4+ TCR pathway;PID Curated;200129

Pathway

B cell activation;PANTHER;P00010

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

regulation of map kinase pathways through dual specificity phosphatases;PID BioCarta;100185

Pathway

Activation of BH3-only proteins;PID Reactome;500260

Pathway

ceramide signaling pathway;PID BioCarta;100206

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Cell death signalling via NRAGE, NRIF and NADE;PID Reactome;500608

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

Ras Pathway;PANTHER;P04393

Pathway

FAS signaling pathway;PANTHER;P00020

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

S1P2 pathway;PID Curated;200181

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

bone remodeling;PID BioCarta;100052

Pathway

Activation of BIM and translocation to mitochondria;PID Reactome;500262

Pathway

nerve growth factor pathway (ngf);PID BioCarta;100096

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

role of mal in rho-mediated activation of srf;PID BioCarta;100114

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

tnf/stress related signaling;PID BioCarta;100026

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

NRAGE signals death through JNK;PID Reactome;500609

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Parkinson disease;PANTHER;P00049

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Rapid glucocorticoid signaling;PID Curated;200090

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

il12 and stat4 dependent signaling pathway in th1 development;PID BioCarta;100133

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

FoxO family signaling;PID Curated;200091

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

External Links

Links to Entrez Gene

5599

Links to all GeneRIF Items

5599

Links to iHOP

5599

Sequence Information

Nucleotide Sequence

>5599 : length: 1155
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgattgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttatgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttagca
caggtgcagcagtga

Protein Sequence

>5599 : length: 384
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLAQVQQ



')