Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5598

Name

MAPK7

Synonym

BMK1|ERK4|ERK5|PRKM7;mitogen-activated protein kinase 7;MAPK7;mitogen-activated protein kinase 7

Definition

BMK-1|BMK1 kinase|ERK-5|MAP kinase 7|MAPK 7|big MAP kinase 1|extracellular signal-regulated kinase 5|extracellular-signal-regulated kinase 5

Position

17p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

ERK/MAPK targets;PID Reactome;500455

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

control of skeletal myogenesis by hdac and calcium/calmodulin-dependent kinase (camk);PID BioCarta;100148

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

Signalling to ERK5;PID Reactome;500644

External Links

Links to Entrez Gene

5598

Links to all GeneRIF Items

5598

Links to iHOP

5598

Sequence Information

Nucleotide Sequence

>5598 : length: 2451
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaaacacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctgaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgactgag
tatgtggccacgcgctggtaccgtgcgcccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactatgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgctcgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgcgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccacca
tgccccggccctgcacctgacaccattgatctgaccctgcagccacctccaccagtcagt
gagcctgccccaccaaagaaagatggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagcgcacccctggag
gctcctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttggaacgctggactcgaatggcccggcccgcagcc
ccagccctcacctctgtgccggcccctgccccagcgccaacgccaaccccaaccccagtc
caacctaccagtcctcctcctggccctgtagcccagcccactggcccgcaaccacaatct
gcgggctctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccc
caccccactggccctcctgggcccatccctgtccccgcgccaccccagattgccacctcc
accagcctcctggctgcccagtcacttgtgccaccccctgggctgcctggctccagcacc
ccaggagttttgccttacttcccacctggcctgccgcccccagacgccgggggagcccct
cagtcttccatgtcagagtcacctgatgtcaaccttgtgacccagcagctatctaagtca
caggtggaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggc
tacggtgttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggct
gatgggccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgac
tggctcgaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccag
atggactccccaatgctgctggctgacctgcctgacctccaggacccctga

Protein Sequence

>5598 : length: 816
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATS
TSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP



')