Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5594

Name

MAPK1

Synonym

ERK|ERK2|ERT1|MAPK2|P42MAPK|PRKM1|PRKM2|p38|p40|p41|p41mapk;mitogen-activated protein kinase 1;MAPK1;mitogen-activated protein kinase 1

Definition

ERK-2|MAP kinase 1|MAP kinase 2|MAP kinase isoform p42|MAPK 2|extracellular signal-regulated kinase 2|mitogen-activated protein kinase 2|p42-MAPK|protein tyrosine kinase ERK2

Position

22q11.2|22q11.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

Class IB PI3K non-lipid kinase events;PID Curated;200081

Pathway

ccr3 signaling in eosinophils;PID BioCarta;100215

Pathway

mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

sprouty regulation of tyrosine kinase signals;PID BioCarta;100029

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

aspirin blocks signaling pathway involved in platelet activation;PID BioCarta;100030

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

regulation of splicing through sam68;PID BioCarta;100036

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

Opioid Signalling;Reactome;REACT:15295

Pathway

Endothelins;PID Curated;200004

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

how progesterone initiates the oocyte maturation;PID BioCarta;100104

Pathway

erk1/erk2 mapk signaling pathway;PID BioCarta;100170

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

S1P4 pathway;PID Curated;200043

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

mcalpain and friends in cell motility;PID BioCarta;100111

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

L1CAM interactions;PID Reactome;500097

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Ras signaling in the CD4+ TCR pathway;PID Curated;200088

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Interferon-gamma signaling pathway;PANTHER;P00035

Pathway

Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

human cytomegalovirus and map kinase pathways;PID BioCarta;100149

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

RSK activation;PID Reactome;500179

Pathway

Recycling pathway of L1;PID Reactome;500098

Pathway

transcription factor creb and its extracellular signals;PID BioCarta;100198

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

B cell activation;PANTHER;P00010

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

role of beta-arrestins in the activation and targeting of map kinases;PID BioCarta;100229

Pathway

Angiogenesis;PANTHER;P00005

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

ceramide signaling pathway;PID BioCarta;100206

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

melanocyte development and pigmentation pathway;PID BioCarta;100108

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

S1P1 pathway;PID Curated;200071

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

FGF signaling pathway;PID Curated;200189

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

ERK2 activation;PID Reactome;500086

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

CREB phophorylation through the activation of Ras;PID Reactome;500177

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

TRAIL signaling pathway;PID Curated;200056

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Synaptic Transmission;Reactome;REACT:13685

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Netrin-mediated signaling;PID Curated;200074

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Pathway

Hemostasis;Reactome;REACT:604

Pathway

role of mal in rho-mediated activation of srf;PID BioCarta;100114

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

phosphorylation of mek1 by cdk5/p35 down regulates the map kinase pathway;PID BioCarta;100210

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

stat3 signaling pathway;PID BioCarta;100028

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

VEGFR3 signaling in lymphatic endothelium;PID Curated;200188

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Dorso-ventral axis formation;KEGG PATHWAY;hsa04320

Pathway

Arf6 downstream pathway;PID Curated;200079

Pathway

roles of beta arrestin dependent recruitment of src kinases in gpcr signaling;PID BioCarta;100230

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Parkinson disease;PANTHER;P00049

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

Cellular roles of Anthrax toxin;PID Curated;200179

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Signal transduction by L1;PID Reactome;500100

Pathway

fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

MAP kinase cascade;BioCyc;PWY66-14

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

Ras Pathway;PANTHER;P04393

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

alcohol consumption;GAD

Disease

CHEMDEPENDENCY;GAD

External Links

Links to Entrez Gene

5594

Links to all GeneRIF Items

5594

Links to iHOP

5594

Sequence Information

Nucleotide Sequence

>5594 : length: 1083
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaatgaccatatctgctattttctctaccagatcctcagagggttaaaatatatc
cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac
acagggttcctgacagaatatgtggccacacgttggtacagggctccagaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaa
atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt
ttgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggacttattggacaaaatgttgacattcaacccacacaag
aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt
gacgagcccatcgccgaagcaccattcaagttcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactaatttttgaagagactgctagattccagccaggatacagatct
taa

Protein Sequence

>5594 : length: 360
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS



')