Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

55914

Name

ERBB2IP

Synonym

ERBIN|LAP2;erbb2 interacting protein;ERBB2IP;erbb2 interacting protein

Definition

densin-180-like protein|protein LAP2

Position

5q12.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

External Links

Links to Entrez Gene

55914

Links to all GeneRIF Items

55914

Links to iHOP

55914

Sequence Information

Nucleotide Sequence

>55914 : length: 3909
atgactacaaaacgaagtttgtttgtgcggttggtaccatgtcgctgtctacgaggggaa
gaggagactgtcactactcttgattattctcattgcagcttagaacaagttccgaaagag
atttttacttttgaaaaaaccttggaggaactctatttagatgctaatcagattgaagag
cttccaaagcaactttttaactgtcagtctttacacaaactgagtttgccagacaatgat
ttaacaacgttaccagcatccattgcaaaccttattaatctcagggaactggatgtcagc
aagaatggaatacaggagtttccagaaaatataaaaaattgtaaagttttgacaattgtg
gaggccagtgtaaaccctatttccaagctccctgatggattttctcagctgttaaaccta
acccagttgtatctgaatgatgcttttcttgagttcttgccagcaaattttggcagatta
actaaactccaaatattagagcttagagaaaaccagttaaaaatgttgcctaaaactatg
aatagactgacccagctggaaagattggatttgggaagtaacgaattcacggaagtgcct
gaagtacttgagcaactaagtggattgaaagagttttggatggatgctaatagactgact
tttattccagggtttattggtagtttgaaacagctcacatatttggatgtttctaaaaat
aatattgaaatggttgaagaaggaatttcaacatgtgaaaaccttcaagacctcctatta
tcaagcaattcacttcagcagcttcctgagactattggttcgttgaagaatataacaacg
cttaaaatagatgaaaaccagttaatgtatctgccagactctataggagggttaatatca
gtagaagaactggattgtagtttcaatgaagttgaagctttgccttcatctattgggcag
cttactaacttaagaacttttgctgctgatcataattacttacagcagttgcccccagag
attggaagctggaaaaatataactgtgctgtttctccattccaataaacttgagacactt
ccagaggaaatgggtgatatgcaaaaattaaaagtcattaatttaagtgataatagatta
aagaatttaccctttagctttacaaagctacagcaattgacagctatgtggctctcagat
aatcagtccaaacccctgatacctcttcaaaaagaaactgattcagagacccagaaaatg
gtgcttaccaactacatgttccctcaacagccaaggactgaggatgttatgtttatatca
gataatgaaagttttaacccttcattgtgggaggaacagaggaaacagcgggctcaagtt
gcatttgaatgtgatgaagacaaagatgaaagggaggcacctcccagggagggaaattta
aaaagatatccaacaccatacccagatgagcttaagaatatggtcaaaactgttcaaacc
attgtacatagattaaaagatgaagagaccaatgaagactcaggaagagatttgaaacca
catgaagatcaacaagatataaataaagatgtgggtgtgaagacctcagaaagtactact
acagtaaaaagcaaagttgatgaaagagaaaaatatatgataggaaactctgtacagaag
atcagtgaacctgaagctgagattagtcctgggagtttaccagtgactgcaaatatgaaa
gcctctgagaacttgaagcatattgttaaccatgatgatgtttttgaggaatctgaagaa
ctttcttctgatgaagagatgaaaatggcggagatgcgaccaccattaattgaaacctct
attaaccagccaaaagtcgtagcacttagtaataacaaaaaagatgatacaaaggaaaca
gattctttatcagatgaagttacacacaatagcaatcagaataacagcaattgttcttct
ccatctcggatgtctgattcagtttctcttaatactgatagtagtcaagacacctcactc
tgctctccagtgaaacaaactcatattgatattaattccaaaatcaggcaagaagatgaa
aattttaacagccttttacaaaatggagatattttaaacagttcaacagaggaaaagttc
aaagctcatgataaaaaagattttaacttacctgaatatgatttgaatgttgaagagcga
ttagttctaattgagaaaagtgttgactcaacagccacagctgatgacactcacaaatta
gatcatatcaatatgaatcttaataaacttataactaatgatacatttcaaccagagatc
atggaaagatcaaaaacacaggatattgtgcttggaacaagctttttaagcattaattct
aaagaggaaactgagcacttggaaaatggaaacaagtatcctaatttggaatccgtaaat
aaggtaaatggacattctgaggaaacttcccagtctcctaataggactgaaccacatgac
agtgattgttctgttgacttaggtatttccaaaagcactgaagatctctcccctcagaaa
agtggtccagttggatctgttgtgaaatctcatagcataactaatatggagattggaggg
ctaaaaatctatgatattcttagtgataatggacctcagcagccaagtacaaccgttaaa
atcacatctgctgttgatggaaaaaatatagtcaggagcaagtctgccacactgttgtat
gatcaaccattgcaggtatttactggttcttcctcatcttctgatttaatatcaggaaca
aaggcaattttcaagtttgattcaaatcataatcccgaagagccaaatataataagaggc
cccacaagtggcccacaatctgcacctcaaatatatggtcctccacagtataatatccaa
tacagtagcagtgctgcagtcaaagacactttgtggcactccaaacaaaatccccaaata
gaccatgccagttttcctcctcagctccttcctagatcagagagcacagaaaatcaaagt
tatgctaaacattctgccaatatgaatttctctaatcataacaatgttcgagctaatact
gcataccatttacatcagagacttggcccagcaagacatggggaaatgtgggccatctca
ccaaacgaccgacttattcctgcagtaactcgaagtacaatccagcgacaaagtagtgtg
tcctccacagcctctgtaaatcttggtgatccaggctctacaaggcgggctcagattcct
gaaggagattatttatcatacagagagttccactcagcgggaagaactcctccaatgatg
ccaggatcacagagacccctttctgcacgaacatacagcatagatggtccaaatgcatca
agacctcagagtgctcgaccctctattaatgaaataccagagagaactatgtcagttagt
gatttcaattattcacggactagtccttcaaaaagaccaaatgcaagggttggttctgag
cattctttattagatcctccaggaaaaagtaaagttcctcgtgactggagagaacaagta
cttcgacatattgaagccaaaaagttagaaaagattcgagtgagggttgaaaaggatcca
gaacttggatttagcatatcaggtggtgtcgggggtagaggaaacccattcagacctgat
gatgatggtatatttgtaacaagggtacaacctgaaggaccagcatcaaaattactgcag
ccaggtgataaaattattcaggctaatggctacagttttataaatattgaacatggacaa
gcagtgtccttgctaaaaactttccagaatacagttgaactcatcattgtacgagaagtt
tcctcataa

Protein Sequence

>55914 : length: 1302
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEE
LPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIV
EASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTM
NRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKN
NIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLIS
VEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETL
PEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKM
VLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNL
KRYPTPYPDELKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTT
TVKSKVDEREKYMIGNSVQKISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEE
LSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSS
PSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDENFNSLLQNGDILNSSTEEKF
KAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKLITNDTFQPEI
MERSKTQDIVLGTSFLSINSKEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHD
SDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGGLKIYDILSDNGPQQPSTTVK
ITSAVDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRG
PTSGPQSAPQIYGPPQYNIQYSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQS
YAKHSANMNFSNHNNVRANTAYHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQRQSSV
SSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMMPGSQRPLSARTYSIDGPNAS
RPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPRDWREQV
LRHIEAKKLEKIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQ
PGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS



')