Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

55824

Name

PAG1

Synonym

CBP|PAG;phosphoprotein associated with glycosphingolipid microdomains 1;PAG1;phosphoprotein associated with glycosphingolipid microdomains 1

Definition

Csk-binding protein|phosphoprotein associated with glycosphingolipid-enriched microdomains 1|transmembrane adapter protein PAG|transmembrane adaptor protein PAG|transmembrane phosphoprotein Cbp

Position

8q21.13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Phosphorylation of CD3 and TCR zeta chains;PID Reactome;500479

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Gab1 signalosome;PID Reactome;500514

External Links

Links to Entrez Gene

55824

Links to all GeneRIF Items

55824

Links to iHOP

55824

Sequence Information

Nucleotide Sequence

>55824 : length: 1299
atggggcccgcggggagcctgctgggcagcggacagatgcagatcaccctgtggggaagt
ctggctgctgtcgccattttcttcgtcatcaccttcctcatcttcctgtgctctagttgt
gacagggaaaagaagccgcgacagcatagtggggaccatgagaacctgatgaacgtgcct
tcagacaaggagatgttcagccgttcagttactagcctggcaacagatgctcctgccagc
agtgagcagaatggggcactcaccaatggggacattctttcagaggacagtactctgacc
tgcatgcagcattacgaggaagtccagacatcggcctcggatctgctggattcccaggac
agcacagggaaaccaaaatgtcatcagagtcgggagctgcccagaatccctcccgagagc
gcagtggataccatgctcacggcgagaagtgtggacggggaccaggggctggggatggaa
gggccctatgaagtgctcaaggacagctcctcccaagaaaacatggtggaggactgcttg
tatgaaactgtgaaagagatcaaggaggtggctgcagctgcacacctggagaaaggccac
agtggcaaggcaaaatctacttctgcctcgaaagagctcccagggccccagactgaaggc
aaagctgagtttgctgaatatgcctcggtggacagaaacaaaaaatgtcgtcaaagtgtt
aatgtagagagtatccttggaaattcatgtgatccagaagaggaggccccaccacctgtc
cctgttaagcttctggacgagaatgaaaaccttcaggagaaggaagggggagaggcggaa
gagagtgccacagacacgaccagtgaaactaacaagagatttagctcattgtcatacaag
tctcgggaagaagaccccactctcacagaagaagagatctcagctatgtactcatcagta
aataaacctggacagttagtgaataaatcggggcagtcgcttacagttccggagtccacc
tacacctccattcaaggggacccacagaggtcaccctcctcctgtaatgatctctatgct
actgttaaagacttcgaaaaaactccaaacagcacacttccaccagcagggaggcccagc
gaggagccagagcctgattatgaagcgatacagactctcaacagagaggaagaaaaggcc
accctggggaccaatggccaccacggtctcgtcccaaaggagaacgactacgagagcata
agtgacttgcagcaaggcagagatattaccaggctctag

Protein Sequence

>55824 : length: 432
MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVP
SDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQD
STGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCL
YETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSV
NVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYK
SREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYA
TVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESI
SDLQQGRDITRL



')