Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

55818

Name

KDM3A

Synonym

JHDM2A|JHMD2A|JMJD1|JMJD1A|TSGA;lysine (K)-specific demethylase 3A;KDM3A;lysine (K)-specific demethylase 3A

Definition

jmjC domain-containing histone demethylation protein 2A|jumonji C domain-containing histone demethylase 2A|jumonji domain containing 1|jumonji domain containing 1A|jumonji domain-containing protein 1A|lysine-specific demethylase 3A|testis-specific protein

Position

2p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

External Links

Links to Entrez Gene

55818

Links to all GeneRIF Items

55818

Links to iHOP

55818

Sequence Information

Nucleotide Sequence

>55818 : length: 3966
atggtgctcacgctcggagaaagttggccggtattggtggggaggaggtttctcagtctg
tccgcagccgacggcagcgatggcagccacgacagctgggacgtggagcgcgtcgccgag
tggccctggctctccgggaccattcgagctgtttcccacaccgacgttaccaagaaggat
ctgaaggtgtgtgtggaatttgatggggaatcttggaggaaaagaagatggatagaagtc
tacagccttctaaggagagcatttttagtagaacataatttggttttagctgaacgaaag
tcacctgaaatttctgaacgaattgtacagtggcctgcaataacgtacaaacctctgttg
gacaaagctggtttgggatccataacttctgttcgctttctgggagatcaacaaagagta
tttctttctaaagaccttttgaagcctatacaggatgtaaacagtcttcgactttctctt
acggataatcagattgtcagtaaagaatttcaagctttgattgtgaagcatttagatgaa
agccatcttttaaaaggtgacaaaaacttagttggttcagaagtaaaaatttatagcttg
gacccatctactcagtggttttcagcaaccgttataaatggaaacccagcatcaaaaact
cttcaagtcaactgtgaggagattccagcactgaaaattgttgatccgtcactgattcat
gttgaagttgtacacgataaccttgtgacatgtggtaattctgcaagaattggagctgta
aaacgcaagtcttctgagaataatggaaccctggtttccaaacaagcaaaatcttgctct
gaggcctctcccagtatgtgtcctgtgcagtctgtacctacaacagtttttaaggagata
ctgcttggctgtactgcggcaactccacctagtaaggacccaagacagcaaagtactccc
caggctgccaactctccacctaaccttggagcaaaaattcctcaaggatgtcataaacaa
agtttaccagaggaaatttcttcctgtctaaatacaaagtctgaagctctgagaacaaaa
ccagatgtctgcaaagcagggttgctctcaaagtcctctcagattggaactggagacttg
aaaattctgactgagccaaaaggcagctgtactcagcctaagacaaacactgatcaggaa
aacagattggagtctgttccacaagcattgactggccttcctaaggagtgcttacctaca
aaggcttcttctaaggcagaattggaaattgccaatcctcctgaactgcagaagcaccta
gaacatgcaccttccccatcggatgtttcaaatgcaccagaagtgaaagcaggtgtcaat
agtgatagccctaataactgttcaggaaaaaaggtagaaccttcagctttagcttgccga
tcacagaatttaaaggaatcttcagtaaaagtagataatgaaagctgttgttcaagaagc
aacaataaaatccagaatgccccatccaggaagtcggttttgacagacccagctaaactc
aaaaagctgcaacagagtggcgaggccttcgtacaggatgattcttgtgtgaacatcgtg
gcacagttgcctaaatgccgagagtgtcgcttggacagtctccgcaaggataaggagcaa
cagaaggactcacctgtgttttgccgcttctttcacttcaggaggttacaattcaacaaa
catggtgtgttgcgggtagaaggcttcttaacaccaaacaagtatgacaatgaagcaatt
ggcttgtggttacctttaaccaaaaacgttgtggggattgatttggacacagcaaagtac
atcttggccaacattggagaccacttctgtcaaatggtgatttctgaaaaggaagctatg
tcaactattgagccacacagacaggttgcttggaagcgagctgtcaaaggtgttcgagaa
atgtgtgatgtgtgcgacaccaccatcttcaacctgcactgggtgtgtcctcggtgtggg
tttggagtatgtgtggactgctaccggatgaagagaaagaattgccaacagggtgctgct
tacaagactttctcttggctaaaatgtgtgaagagtcagatacatgaaccagagaactta
atgcccacacagatcattcctggaaaagcactctatgatgttggagacattgttcattct
gtaagagcgaaatggggaataaaggcaaactgcccttgttcaaacaggcaattcaaactc
ttttcaaagccagcctcaaaggaagacctaaaacagacttctttagctggagaaaaaccg
actcttggtgcagtgctccagcagaatccctcagtgttggagccagcagctgtgggtggg
gaagcagcctccaagccagccggcagcatgaagcctgcctgtccagccagcacatctcct
ctaaactggctggccgacctaaccagcgggaatgtcaacaaggaaaacaaggaaaaacaa
ccaacaatgccaattttaaagaatgaaatcaaatgccttccacccctcccacctttaagc
aaatccagcacagtcctccatacgtttaacagcacaattttgacacccgtaagcaacaac
aattctggtttcctccggaatctcttgaattcttctacaggaaagacagaaaatggactc
aagaatacaccaaaaatccttgatgacatctttgcctctttggtgcaaaataagacgact
tctgatttatctaagaggcctcaaggactaaccatcaagcccagcattctgggctttgac
actcctcactattggctttgtgataatcgcttgctgtgcttgcaagaccccaacaataag
agcaactggaatgtgtttagggagtgctggaaacaagggcagccagtgatggtgtctgga
gtgcatcataaattgaactctgaactttggaaacctgaatccttcaggaaagagtttggt
gagcaggaagtagacctagttaattgtaggaccaatgaaatcatcacaggagccacagta
ggagacttctgggatggatttgaagatgttccaaatcgtttgaaaaatgaaaaagaacca
atggtgttgaaacttaaggactggccaccaggagaagattttagagatatgatgccttcc
aggtttgatgatctgatggccaacattccactgcccgagtacacaaggcgagatggcaaa
ctgaatttggcctctaggctgccaaactactttgttcggccagatctgggccccaagatg
tataatgcttatggattaatcactcctgaagatcggaaatatggaacaacaaatcttcac
ttagatgtatctgatgcagctaatgtcatggtctatgtgggaattcccaaaggacagtgt
gagcaagaagaagaagtccttaagaccatccaagatggagattctgacgaactcacaata
aagcgatttattgaaggaaaagagaagccaggagcactgtggcacatatatgctgcaaag
gacacggagaagataagggaatttcttaaaaaggtatcagaagagcaaggtcaagaaaac
ccagcagaccacgatcctattcatgatcaaagctggtatttagaccgatcattaagaaaa
cgtcttcatcaagagtatggagttcaaggctgggctattgtacagtttcttggggatgtg
gtgtttatcccggcaggagctccacatcaggttcataacttatatagctgcatcaaagtg
gctgaagattttgtttctccagagcatgttaaacactgcttctggcttactcaggaattc
cgatatctgtcacagactcataccaatcacgaagataaattacaggtgaagaatgttatc
taccatgcagtgaaagatgcagttgctatgctgaaagccagtgaatccagttttggcaaa
ccttaa

Protein Sequence

>55818 : length: 1321
MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKD
LKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLL
DKAGLGSITSVRFLGDQQRVFLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDE
SHLLKGDKNLVGSEVKIYSLDPSTQWFSATVINGNPASKTLQVNCEEIPALKIVDPSLIH
VEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEI
LLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLNTKSEALRTK
PDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACR
SQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIV
AQLPKCRECRLDSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAI
GLWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWLKCVKSQIHEPENL
MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDLKQTSLAGEKP
TLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGL
KNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
SNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
GDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGK
LNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQC
EQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQEN
PADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGK
P



')