Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5581

Name

PRKCE

Synonym

PKCE|nPKC-epsilon;protein kinase C, epsilon;PRKCE;protein kinase C, epsilon

Definition

protein kinase C epsilon type

Position

2p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

5HT2 type receptor mediated signaling pathway;PANTHER;P04374

Pathway

Muscarinic acetylcholine receptor 1 and 3 signaling pathway;PANTHER;P00042

Pathway

Thyrotropin-releasing hormone receptor signaling pathway;PANTHER;P04394

Pathway

LPA4-mediated signaling events;PID Curated;200036

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

cardiac protection against ros;PID BioCarta;100163

Pathway

Alpha adrenergic receptor signaling pathway;PANTHER;P00002

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Endothelins;PID Curated;200004

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

protein kinase a at the centrosome;PID BioCarta;100246

Pathway

Histamine H1 receptor mediated signaling pathway;PANTHER;P04385

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Oxytocin receptor mediated signaling pathway;PANTHER;P04391

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Disease

Hematocrit;NHGRI

Disease

HEMATOLOGICAL;GAD

Disease

Hematological and biochemical traits;NHGRI

Disease

Hemoglobin;NHGRI

Disease

hemoglobin;GAD

Disease

hematocrit;GAD

External Links

Links to Entrez Gene

5581

Links to all GeneRIF Items

5581

Links to iHOP

5581

Sequence Information

Nucleotide Sequence

>5581 : length: 2214
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccgcagactttccttctcgacccc
tacattgccctcaatgtggacgactcgcgcatcggccaaacggccaccaagcagaagacc
aacagcccggcctggcacgacgagttcgtcaccgatgtgtgcaacggacgcaagatcgag
ctggctgtctttcacgatgcccccataggctacgacgacttcgtggccaactgcaccatc
cagtttgaggagctgctgcagaacgggagccgccacttcgaggactggattgatctggag
ccagaaggaagagtgtatgtgatcatcgatctctcagggtcgtcgggtgaagcccctaaa
gacaatgaagagcgtgtgttcagggaacgcatgcggccgaggaagcggcagggggccgtc
aggcgcagggtccatcaggtcaacggccacaagttcatggccacctatcttcggcagccc
acctactgctcccattgcagagacttcatctggggtgtcataggaaagcagggataccag
tgtcaagtctgcacctgcgtggtccacaagcggtgccacgagctcataatcacaaagtgt
gctgggttaaagaagcaggagacccccgaccaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcggtatccacaactacaaggtccctaccttctgcgatcactgtggg
tccctgctctggggactcttgcggcagggtttgcagtgtaaagtctgcaaaatgaatgtt
caccgtcgatgtgagaccaacgtggctcccaactgtggagtggatgccagaggaatcgcc
aaagtactggccgacctgggcgttaccccagacaaaatcaccaacagcggccagagaagg
aaaaagctcattgctggtgccgagtccccgcagcctgcttctggaagctcaccatctgag
gaagatcgatccaagtcagcacccacctccccttgtgaccaggaaataaaagaacttgag
aacaacattcggaaagccttgtcatttgacaaccgaggagaggagcaccgggcagcatcg
tctcctgatggccagctgatgagccccggtgagaatggcgaagtccggcaaggccaggcc
aagcgcctgggcctggatgagttcaacttcatcaaggtgttgggcaaaggcagctttggc
aaggtcatgttggcagaactcaagggcaaagatgaagtatatgctgtgaaggtcttaaag
aaggacgtcatccttcaggatgatgacgtggactgcacaatgacagagaagaggattttg
gctctggcacggaaacacccgtaccttacccaactctactgctgcttccagaccaaggac
cgcctctttttcgtcatggaatatgtaaatggtggagacctcatgtttcagattcagcgc
tcccgaaaattcgacgagcctcgttcacggttctatgctgcagaggtcacatcggccctc
atgttcctccaccagcatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggctgacttcgggatgtgcaaggaagggattctgaat
ggtgtgacgaccaccacgttctgtgggactcctgactacatagctcctgagatcctgcag
gagttggagtatggcccctccgtggactggtgggccctgggggtgctgatgtacgagatg
atggctggacagcctccctttgaggccgacaatgaggacgacctatttgagtccatcctc
catgacgacgtgctgtacccagtctggctcagcaaggaggctgtcagcatcttgaaagct
ttcatgacgaagaatccccacaagcgcctgggctgtgtggcatcgcagaatggcgaggac
gccatcaagcagcacccattcttcaaagagattgactgggtgctcctggagcagaagaag
atcaagccacccttcaaaccacgcattaaaaccaaaagagacgtcaataattttgaccaa
gactttacccgggaagagccggtactcacccttgtggacgaagcaattgtaaagcagatc
aaccaggaggaattcaaaggtttctcctactttggtgaagacctgatgccctga

Protein Sequence

>5581 : length: 737
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP



')