Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

558

Name

AXL

Synonym

JTK11|UFO;AXL receptor tyrosine kinase;AXL;AXL receptor tyrosine kinase

Definition

AXL oncogene|AXL transforming sequence/gene|oncogene AXL|tyrosine-protein kinase receptor UFO

Position

19q13.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

558

Links to all GeneRIF Items

558

Links to iHOP

558

Sequence Information

Nucleotide Sequence

>558 : length: 2658
atggcgtggcggtgccccaggatgggcagggtcccgctggcctggtgcttggcgctgtgc
ggctgggcgtgcatggcccccaggggcacgcaggctgaagaaagtcccttcgtgggcaac
ccagggaatatcacaggtgcccggggactcacgggcacccttcggtgtcagctccaggtt
cagggagagccccccgaggtacattggcttcgggatggacagatcctggagctcgcggac
agcacccagacccaggtgcccctgggtgaggatgaacaggatgactggatagtggtcagc
cagctcagaatcacctccctgcagctttccgacacgggacagtaccagtgtttggtgttt
ctgggacatcagaccttcgtgtcccagcctggctatgttgggctggagggcttgccttac
ttcctggaggagcccgaagacaggactgtggccgccaacacccccttcaacctgagctgc
caagctcagggacccccagagcccgtggacctactctggctccaggatgctgtccccctg
gccacggctccaggtcacggcccccagcgcagcctgcatgttccagggctgaacaagaca
tcctctttctcctgcgaagcccataacgccaagggggtcaccacatcccgcacagccacc
atcacagtgctcccccagcagccccgtaacctccacctggtctcccgccaacccacggag
ctggaggtggcttggactccaggcctgagcggcatctaccccctgacccactgcaccctg
caggctgtgctgtcagacgatgggatgggcatccaggcgggagaaccagaccccccagag
gagcccctcacctcgcaagcatccgtgcccccccatcagcttcggctaggcagcctccat
cctcacaccccttatcacatccgcgtggcatgcaccagcagccagggcccctcatcctgg
acccactggcttcctgtggagacgccggagggagtgcccctgggcccccctgagaacatt
agtgctacgcggaatgggagccaggccttcgtgcattggcaagagccccgggcgcccctg
cagggtaccctgttagggtaccggctggcgtatcaaggccaggacaccccagaggtgcta
atggacatagggctaaggcaagaggtgaccctggagctgcagggggacgggtctgtgtcc
aatctgacagtgtgtgtggcagcctacactgctgctggggatggaccctggagcctccca
gtacccctggaggcctggcgcccagtgaaggaaccttcaactcctgccttctcgtggccc
tggtggtatgtactgctaggagcagtcgtggccgctgcctgtgtcctcatcttggctctc
ttccttgtccaccggcgaaagaaggagacccgttatggagaagtgtttgaaccaacagtg
gaaagaggtgaactggtagtcaggtaccgcgtgcgcaagtcctacagtcgtcggaccact
gaagctaccttgaacagcctgggcatcagtgaagagctgaaggagaagctgcgggatgtg
atggtggaccggcacaaggtggccctggggaagactctgggagagggagagtttggagct
gtgatggaaggccagctcaaccaggacgactccatcctcaaggtggctgtgaagacgatg
aagattgccatctgcacgaggtcagagctggaggatttcctgagtgaagcggtctgcatg
aaggaatttgaccatcccaacgtcatgaggctcatcggtgtctgtttccagggttctgaa
cgagagagcttcccagcacctgtggtcatcttacctttcatgaaacatggagacctacac
agcttcctcctctattcccggctcggggaccagccagtgtacctgcccactcagatgcta
gtgaagttcatggcagacatcgccagtggcatggagtatctgagtaccaagagattcata
caccgggacctggcggccaggaactgcatgctgaatgagaacatgtccgtgtgtgtggcg
gacttcgggctctccaagaagatctacaatggggactactaccgccagggacgtatcgcc
aagatgccagtcaagtggattgccattgagagtctagctgaccgtgtctacaccagcaag
agcgatgtgtggtccttcggggtgacaatgtgggagattgccacaagaggccaaacccca
tatccgggcgtggagaacagcgagatttatgactatctgcgccagggaaatcgcctgaag
cagcctgcggactgtctggatggactgtatgccttgatgtcgcggtgctgggagctaaat
ccccaggaccggccaagttttacagagctgcgggaagatttggagaacacactgaaggcc
ttgcctcctgcccaggagcctgacgaaatcctctatgtcaacatggatgagggtggaggt
tatcctgaaccccctggagctgcaggaggagctgaccccccaacccagccagaccctaag
gattcctgtagctgcctcactgcggctgaggtccatcctgctggacgctatgtcctctgc
ccttccacaacccctagccccgctcagcctgctgataggggctccccagcagccccaggg
caggaggatggtgcctga

Protein Sequence

>558 : length: 885
MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQV
QGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVF
LGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPL
ATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTE
LEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPL
QGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTV
ERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGA
VMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSE
RESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFI
HRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSK
SDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYALMSRCWELN
PQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGADPPTQPDPK
DSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA



')