Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5578

Name

PRKCA

Synonym

AAG6|PKC-alpha|PKCA|PRKACA;protein kinase C, alpha;PRKCA;protein kinase C, alpha

Definition

PKC-A|aging-associated gene 6|protein kinase C alpha type

Position

17q22-q23.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Phosphatidylinositol signaling system;KEGG PATHWAY;hsa04070

Pathway

Integration of energy metabolism;Reactome;REACT:1505

Pathway

Vibrio cholerae infection;KEGG PATHWAY;hsa05110

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

5HT2 type receptor mediated signaling pathway;PANTHER;P04374

Pathway

Muscarinic acetylcholine receptor 1 and 3 signaling pathway;PANTHER;P00042

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Thyrotropin-releasing hormone receptor signaling pathway;PANTHER;P04394

Pathway

Salivary secretion;KEGG PATHWAY;hsa04970

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Ras signaling in the CD4+ TCR pathway;PID Curated;200088

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Opioid Signalling;Reactome;REACT:15295

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

Alpha adrenergic receptor signaling pathway;PANTHER;P00002

Pathway

ionomycin and phorbal ester signaling pathway;PID BioCarta;100121

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Endothelins;PID Curated;200004

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

Regulation of Insulin Secretion by Acetylcholine;PID Reactome;500136

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Histamine H1 receptor mediated signaling pathway;PANTHER;P04385

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Canonical NF-kappaB pathway;PID Curated;200026

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

Angiogenesis;PANTHER;P00005

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Oxytocin receptor mediated signaling pathway;PANTHER;P04391

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

Gastric acid secretion;KEGG PATHWAY;hsa04971

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Synaptic Transmission;Reactome;REACT:13685

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Disease

Pituitary tumor, invasive;OMIM

Disease

multiple sclerosis;GAD

Disease

IMMUNE;GAD

External Links

Links to Entrez Gene

5578

Links to all GeneRIF Items

5578

Links to iHOP

5578

Sequence Information

Nucleotide Sequence

>5578 : length: 2019
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccgcagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccggaaggggacgaggaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagagcatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgtggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccacct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

Protein Sequence

>5578 : length: 672
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV



')