Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

54910

Name

SEMA4C

Synonym

M-SEMA-F|SEMACL1|SEMAF|SEMAI;sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C;SEMA4C;sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C

Definition

M-Sema F|semaphorin-4C

Position

2q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

External Links

Links to Entrez Gene

54910

Links to all GeneRIF Items

54910

Links to iHOP

54910

Sequence Information

Nucleotide Sequence

>54910 : length: 2502
atggccccacactgggctgtctggctgctggcagcaaggctgtggggcctgggcattggg
gctgaggtgtggtggaaccttgtgccgcgtaagacagtgtcttctggggagctggccacg
gtagtacggcggttctcccagaccggcatccaggacttcctgacactgacgctgacggag
cccactgggcttctgtacgtgggcgcccgagaggccctgtttgccttcagcatggaggcc
ctggagctgcaaggagcgatctcctgggaggcccccgtggagaagaagactgagtgtatc
cagaaagggaagaacaaccagaccgagtgcttcaacttcatccgcttcctgcagccctac
aatgcctcccacctgtacgtctgtggcacctacgccttccagcccaagtgcacctacgtc
aacatgctcaccttcactttggagcatggagagtttgaagatgggaagggcaagtgtccc
tatgacccagctaagggccatgctggccttcttgtggatggtgagctgtactcggccaca
ctcaacaacttcctgggcacggaacccattatcctgcgtaacatggggccccaccactcc
atgaagacagagtacctggccttttggctcaacgaacctcactttgtaggctctgcctat
gtacctgagagtgtgggcagcttcacgggggacgacgacaaggtctacttcttcttcagg
gagcgggcagtggagtccgactgctatgccgagcaggtggtggctcgtgtggcccgtgtc
tgcaagggcgatatggggggcgcacggaccctgcagaggaagtggaccacgttcctgaag
gcgcggctggcatgctctgccccgaactggcagctctacttcaaccagctgcaggcgatg
cacaccctgcaggacacctcctggcacaacaccaccttctttggggtttttcaagcacag
tggggtgacatgtacctgtcggccatctgtgagtaccagttggaagagatccagcgggtg
tttgagggcccctataaggagtaccatgaggaagcccagaagtgggaccgctacactgac
cctgtacccagccctcggcctggctcgtgcattaacaactggcatcggcgccacggctac
accagctccctggagctacccgacaacatcctcaacttcgtcaagaagcacccgctgatg
gaggagcaggtggggcctcggtggagccgccccctgctcgtgaagaagggcaccaacttc
acccacctggtggccgaccgggttacaggacttgatggagccacctatacagtgctgttc
attggcacaggagacggctggctgctcaaggctgtgagcctggggccctgggttcacctg
attgaggagctgcagctgtttgaccaggagcccatgagaagcctggtgctatctcagagc
aagaagctgctctttgccggctcccgctctcagctggtgcagctgcccgtggccgactgc
atgaagtatcgctcctgtgcagactgtgtcctcgcccgggacccctattgcgcctggagc
gtcaacaccagccgctgtgtggccgtgggtggccactctggatctctactgatccagcat
gtgatgacctcggacacttcaggcatctgcaacctccgtggcagtaagaaagtcaggccc
actcccaaaaacatcacggtggtggcgggcacagacctggtgctgccctgccacctctcc
tccaacttggcccatgcccgctggacctttgggggccgggacctgcctgcggaacagccc
gggtccttcctctacgatgcccggctccaggccctggttgtgatggctgcccagccccgc
catgccggggcctaccactgcttttcagaggagcagggggcgcggctggctgctgaaggc
taccttgtggctgtcgtggcaggcccgtcggtgaccttggaggcccgggcccccctggaa
aacctggggctggtgtggctggcggtggtggccctgggggctgtgtgcctggtgctgctg
ctgctggtgctgtcattgcgccggcggctgcgggaagagctggagaaaggggccaaggct
actgagaggaccttggtgtaccccctggagctgcccaaggagcccaccagtccccccttc
cggccctgtcctgaaccagatgagaaactttgggatcctgtcggttactactattcagat
ggctcccttaagatagtacctgggcatgcccggtgccagcccggtggggggcccccttcg
ccacctccaggcatcccaggccagcctctgccttctccaactcggcttcacctggggggt
gggcggaactcaaatgccaatggttacgtgcgcttacaactaggaggggaggaccgggga
gggctcgggcaccccctgcctgagctcgcggatgaactgagacgcaaactgcagcaacgc
cagccactgcccgactccaaccccgaggagtcatcagtatga

Protein Sequence

>54910 : length: 833
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
PTGLLYVGAREALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYVNMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSAT
LNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFR
ERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYFNQLQAM
HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQS
KKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQH
VMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLE
NLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPF
RPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGG
GRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV



')