Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

54845

Name

ESRP1

Synonym

RBM35A|RMB35A;epithelial splicing regulatory protein 1;ESRP1;epithelial splicing regulatory protein 1

Definition

RNA binding motif protein 35A|RNA-binding motif protein 35A|RNA-binding protein 35A

Position

8q22.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

54845

Links to all GeneRIF Items

54845

Links to iHOP

54845

Sequence Information

Nucleotide Sequence

>54845 : length: 2034
atgacggcctctccggattacttggtggtgctttttgggatcactgctggggccaccggg
gccaagctaggctcggatgagaaggagttgatcctgctgttctggaaagtcgtggatctg
gccaacaagaaggtgggacagttgcacgaagtgctagttagaccggatcagttggaactg
acggaggactgcaaagaagaaactaaaatagacgtcgaaagcctgtcctcggcgtcgcag
ctggaccaagccctccgacagtttaaccagtcagtgagcaatgaactgaatattggagta
gggacttccttctgtctctgtactgatgggcagcttcatgtcaggcaaatcctgcatcct
gaggcttccaagaagaatgtactattacctgaatgcttctattccttttttgatcttcga
aaagaattcaagaaatgttgccctggttcacctgatattgacaaactggacgttgccaca
atgacagagtatttaaattttgagaagagtagttcagtctctcgatatggagcctctcaa
gttgaagatatggggaatataattttagcaatgatttcagagccttataatcacaggttt
tcagatccagagagagtgaattacaagtttgaaagtggaacttgcagcaagatggaactt
attgatgataacaccgtagtcagggcacgaggtttaccatggcagtcttcagatcaagat
attgcaagattcttcaaaggactcaatattgccaagggaggtgcagcactttgtctgaat
gctcagggtcgaaggaacggagaagctctggttaggtttgtaagtgaggagcaccgagac
ctagcactacagaggcacaaacatcacatggggacccggtatattgaggtttacaaagca
acaggtgaagatttccttaaaattgctggtggtacttccaatgaggtagcccagtttctc
tccaaggaaaatcaagtcattgtccgcatgcgggggctccctttcacggccacagctgaa
gaagtggtggccttctttggacagcattgccctattactgggggaaaggaaggcatcctc
tttgtcacctacccagatggtaggccaacaggggacgcttttgtcctctttgcctgtgag
gaatatgcacagaatgcgttgaggaagcataaagacttgttgggtaaaagatacattgaa
ctcttcaggagcacagcagctgaagttcagcaggtgctgaatcgattctcctcggcccct
ctcattccacttccaacccctcccattattccagtactacctcagcaatttgtgccccct
acaaatgttagagactgtatacgccttcgaggtcttccctatgcagccacaattgaggac
atcctggatttcctgggggagttcgccacagatattcgtactcatggggttcacatggtt
ttgaatcaccagggccgcccatcaggagatgcctttatccagatgaagtctgcggacaga
gcatttatggctgcacagaagtgtcataaaaaaaacatgaaggacagatatgttgaagtc
tttcagtgttcagctgaggagatgaactttgtgttaatggggggcactttaaatcgaaat
ggcttatccccaccgccatgcctgtctcctccctcctacacatttccagctcctgctgca
gttattcctacagaagctgccatttaccagccctctgtgattttgaatccacgagcactg
cagccctccacagcgtactacccagcaggcactcagctcttcatgaattacacagcgtac
tatcccagccccccaggttcgcctaatagtcttggctacttccctacagctgctaatctt
agcggtgtccctccacagcctggcacggtggtcagaatgcagggcctggcctacaatact
ggagttaaggaaattcttaacttcttccaaggttaccagtatgcaaccgaggatggactt
atacacacaaatgaccaggccaggactctacccaaagaatgggtttgtatttaa

Protein Sequence

>54845 : length: 677
MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLEL
TEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHP
EASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQ
VEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQD
IARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHMGTRYIEVYKA
TGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHCPITGGKEGIL
FVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP
LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMV
LNHQGRPSGDAFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRN
GLSPPPCLSPPSYTFPAPAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAY
YPSPPGSPNSLGYFPTAANLSGVPPQPGTVVRMQGLAYNTGVKEILNFFQGYQYATEDGL
IHTNDQARTLPKEWVCI



')