Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

54778

Name

RNF111

Synonym

ARK;ring finger protein 111;RNF111;ring finger protein 111

Definition

Arkadia|E3 ubiquitin-protein ligase Arkadia

Position

15q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta receptor signaling;PID Curated;200195

External Links

Links to Entrez Gene

54778

Links to all GeneRIF Items

54778

Links to iHOP

54778

Sequence Information

Nucleotide Sequence

>54778 : length: 2961
atgtctcaatggactcctgaatataacgagctctacaccttaaaagtggatatgaagagt
gagattccttctgatgcaccaaagacacaggagagtctgaaagggatccttttgcatcca
gagcccattggggcagccaaaagttttcctgcaggagttgagatgattaatagtaaagtg
gggaatgaattctctcacctgtgtgatgattctcaaaagcaagagaaggaaatgaatggt
aaccagcaagaacaagaaaaaagtctcgttgtgaggaaaaaacgcaaaagccagcaggct
ggcccttcgtatgtgcagaattgtgttaaagaaaaccagggaatattaggactgaggcaa
cacctagggacaccaagtgatgaagataatgattcctcttttagtgattgtctttcttct
ccttcatctagtctgcattttggagattctgatactgtgacttcagatgaggataaagaa
gtctctgtaagacattcccagaccattttgaatgctaaaagtagaagccatagtgcacgg
tctcataagtggcctcggactgagacagaatctgtatcgggattgttaatgaaaagaccc
tgtttacatggcagttcgttacggagacttccatgcagaaagagatttgtaaaaaataat
tcctcacagaggacacagaaacaaaaagagaggatattaatgcagaggaagaaacgagaa
gtgttagctcgaagaaaatatgccttgctacctagttctagtagttccagtgagaatgac
ctcagcagtgaatcctcttctagctcatcaactgaaggagaagaagatttgtttgtttct
gccagtgaaaaccaccaaaacaatccagctgttccctcaggaagtattgatgaagatgtt
gtggtgatagaagcttcctccactccccaggttactgccaatgaagaaattaatgttacc
tcaactgacagtgaagtggagattgtaacagttggagaaagctatcggtctcgttcaacc
cttggacactccagatctcattggagccagggttccagttctcatgcaagtcggccacag
gagccacggaaccgcagtaggatttctactgttatacagcccttgaggcagaatgcagca
gaagttgtggaccttaccgttgatgaagatgaacctactgtagtaccaaccacttctgca
agaatggaatcacaagctactagcgcttccattaacaattcaaatccatctacctctgag
caggcctctgatactgcttcagctgtcaccagtagccaaccttccacagtgtcagagact
tcagctactcttacaagcaatagtaccactggcacttctataggagatgactcaaggaga
actacatctagtgctgtaacggaaactggccctcctgcaatgccaaggttaccttcctgc
tgtccccagcactcaccatgtggagggtcgtcacagaaccaccatgcattaggacatcct
catacaagttgctttcagcagcatggtcaccattttcaacatcatcaccaccaccaccat
actccccacccagctgtcccagtttctccttcctttagtgatcctgcttgccctgtggaa
agacctccacaagtacaagcaccttgtggagcaaatagtagttctggtaccagctatcat
gaacagcaggcattgccagtggacctgagcaacagtggtatcagaagtcatggaagtggc
agttttcatggagcatctgcatttgacccctgctgccctgtttcttcctcccgagctgca
atctttggccatcaggccgctgctgctgccccaagtcaacctttatcatcaatagatggc
tatggatcaagcatggttgcgcagccccagccccagccccctccacagccctctctctca
tcatgtcgacattacatgccacccccttatgcctctttgacaaggccacttcatcatcaa
gcttctgcctgcccgcattctcatggaaacccccctcctcagactcagcctccgcctcaa
gtggattatgttattcctcatcctgtacatgctttccattctcaaatatcttctcatgca
acatctcatcctgtggcacccccaccaccaactcacttagccagtacagctgcaccaatc
cctcagcatcttcctcctacacaccagccaatttcgcaccatattccagccacagcacct
ccagcacagagactgcatcctcatgaagtgatgcagaggatggaagttcaaaggaggagg
atgatgcagcatccaacgcgggcacatgaacgccccccaccccatccacataggatgcac
ccaaactatggtcatgggcatcatattcatgtgcctcagactatgtcctcacatcctcga
caggctccagagaggtctgcctgggaactgggaattgaagctggagtgactgcagctact
tatacacctggtgcattgcatcctcacttggcccattatcacgcacctcctcgacttcat
cacttacaattaggagctcttcctttaatggttcctgatatggcaggctatcctcacatc
cgttacatttcatcaggattggatggaacatcattcagaggtcctttcaggggcaatttt
gaggaactgattcatttggaagaaagattaggcaatgtcaatcgtggagcatcccagggg
acaattgaaagatgtacatatccacataaatacaaaaagaggaaactgcactgcaaacaa
gatggggaagaagggactgaggaagacacagaggaaaaatgtactatctgtttgtctatt
ttagaggaaggtgaagatgtgagacgtcttccatgtatgcaccttttccaccaagtgtgt
gttgaccaatggttgattaccaataagaagtgccccatatgcagagtggacattgaggcc
cagctgccaagtgaaagttga

Protein Sequence

>54778 : length: 986
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKV
GNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGILGLRQ
HLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSAR
SHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKRE
VLARRKYALLPSSSSSSENDLSSESSSSSSTEGEEDLFVSASENHQNNPAVPSGSIDEDV
VVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQGSSSHASRPQ
EPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSE
QASDTASAVTSSQPSTVSETSATLTSNSTTGTSIGDDSRRTTSSAVTETGPPAMPRLPSC
CPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVE
RPPQVQAPCGANSSSGTSYHEQQALPVDLSNSGIRSHGSGSFHGASAFDPCCPVSSSRAA
IFGHQAAAAAPSQPLSSIDGYGSSMVAQPQPQPPPQPSLSSCRHYMPPPYASLTRPLHHQ
ASACPHSHGNPPPQTQPPPQVDYVIPHPVHAFHSQISSHATSHPVAPPPPTHLASTAAPI
PQHLPPTHQPISHHIPATAPPAQRLHPHEVMQRMEVQRRRMMQHPTRAHERPPPHPHRMH
PNYGHGHHIHVPQTMSSHPRQAPERSAWELGIEAGVTAATYTPGALHPHLAHYHAPPRLH
HLQLGALPLMVPDMAGYPHIRYISSGLDGTSFRGPFRGNFEELIHLEERLGNVNRGASQG
TIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVC
VDQWLITNKKCPICRVDIEAQLPSES



')