Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5468

Name

PPARG

Synonym

CIMT1|GLM1|NR1C3|PPARG1|PPARG2|PPARgamma;peroxisome proliferator-activated receptor gamma;PPARG;peroxisome proliferator-activated receptor gamma

Definition

PPAR gamma|PPAR-gamma|nuclear receptor subfamily 1 group C member 3|peroxisome proliferator-activated nuclear receptor gamma variant 1|peroxisome proliferator-activated receptor gamma 1

Position

3p25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

role of ppar-gamma coactivators in obesity and thermogenesis;PID BioCarta;100065

Pathway

basic mechanism of action of ppara pparb(d) and pparg and effects on gene expression;PID BioCarta;100064

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

visceral fat deposits and the metabolic syndrome;PID BioCarta;100004

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Gene Expression;Reactome;REACT:71

Pathway

PPAR signaling pathway;KEGG PATHWAY;hsa03320

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Type 2 diabetes;NHGRI

Disease

Body Weight;GAD

Disease

increased antilipolytic insulin sensitivity;GAD

Disease

metabolic syndrome;GAD

Disease

Obesity, severe;OMIM

Disease

cardiovascular;GAD

Disease

lipids;GAD

Disease

cholesterol, HDL;GAD

Disease

Diabetes, type 2;OMIM

Disease

exercise-mediated changes of insulin resistance;GAD

Disease

edema;GAD

Disease

obesity;GAD

Disease

triglycerides;GAD

Disease

Increased plasma concentrations of total cholesterol;GAD

Disease

Diabetes;KEGG DISEASE

Disease

Essential Hypertension;GAD

Disease

oxidized low-density lipoprotein and cardiolipin autoantibodies;GAD

Disease

Genetic disorders;KEGG DISEASE

Disease

Insulin resistance, severe, digenic;OMIM

Disease

IMMUNE;GAD

Disease

waist circumference;GAD

Disease

glucose;GAD

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

Familial partial lipodystrophy;KEGG DISEASE;H00420

Disease

PHARMACOGENOMIC;GAD

Disease

birth weight preterm delivery;GAD

Disease

body mass energy metabolism;GAD

Disease

METABOLIC;GAD

Disease

LDL-cholesterol;GAD

Disease

Carotid intimal medial thickness 1;OMIM

Disease

Lipodystrophy, familial partial, type 3;OMIM

Disease

colorectal cancer;GAD

Disease

Bone Mineral Density;GAD

Disease

Insulin Resistance;GAD

Disease

type 2 diabetes;GAD

Disease

diabetes, type 2;GAD

Disease

higher body mass index;GAD

Disease

diabetes, type 1;GAD

Disease

Coronary Artery Disease;GAD

Disease

larger body mass;GAD

Disease

Peripheral Vascular Diseases;GAD

Disease

CARDIOVASCULAR;GAD

Disease

insulin;GAD

Disease

Other genetic disorders;KEGG DISEASE

Disease

NORMALVARIATION;GAD

Disease

higher levels of serum leptin;GAD

Disease

cholesterol, LDL;GAD

Disease

lower lipoprotein lipase activity;GAD

Disease

cardiovascular risk factors;GAD

Disease

Obesity, resistance to;OMIM

Disease

height;GAD

Disease

atherosclerosis, generalized;GAD

Disease

hyperglycemia insulin;GAD

Disease

Glioblastoma, susceptibility to;OMIM

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

Metabolic diseases;KEGG DISEASE

Disease

body mass;GAD

Disease

Hypertension/complications*;GAD

Disease

CANCER;GAD

Disease

HDL cholesterol/ BMI;GAD

Disease

Obesity, Morbid;GAD

Disease

Type II diabetes mellitus;KEGG DISEASE;H00409

Disease

cholesterol, total;GAD

Disease

insulin sensitivity and body composition;GAD

Disease

myocardial infarct;GAD

External Links

Links to Entrez Gene

5468

Links to all GeneRIF Items

5468

Links to iHOP

5468

Sequence Information

Nucleotide Sequence

>5468 : length: 1434
atgaccatggttgacacagagatgccattctggcccaccaactttgggatcagctccgtg
gatctctccgtaatggaagaccactcccactcctttgatatcaagcccttcactactgtt
gacttctccagcatttctactccacattacgaagacattccattcacaagaacagatcca
gtggttgcagattacaagtatgacctgaaacttcaagagtaccaaagtgcaatcaaagtg
gagcctgcatctccaccttattattctgagaagactcagctctacaataagcctcatgaa
gagccttccaactccctcatggcaattgaatgtcgtgtctgtggagataaagcttctgga
tttcactatggagttcatgcttgtgaaggatgcaagggtttcttccggagaacaatcaga
ttgaagcttatctatgacagatgtgatcttaactgtcggatccacaaaaaaagtagaaat
aaatgtcagtactgtcggtttcagaaatgccttgcagtggggatgtctcataatgccatc
aggtttgggcggatgccacaggccgagaaggagaagctgttggcggagatctccagtgat
atcgaccagctgaatccagagtccgctgacctccgggccctggcaaaacatttgtatgac
tcatacataaagtccttcccgctgaccaaagcaaaggcgagggcgatcttgacaggaaag
acaacagacaaatcaccattcgttatctatgacatgaattccttaatgatgggagaagat
aaaatcaagttcaaacacatcacccccctgcaggagcagagcaaagaggtggccatccgc
atctttcagggctgccagtttcgctccgtggaggctgtgcaggagatcacagagtatgcc
aaaagcattcctggttttgtaaatcttgacttgaacgaccaagtaactctcctcaaatat
ggagtccacgagatcatttacacaatgctggcctccttgatgaataaagatggggttctc
atatccgagggccaaggcttcatgacaagggagtttctaaagagcctgcgaaagcctttt
ggtgactttatggagcccaagtttgagtttgctgtgaagttcaatgcactggaattagat
gacagcgacttggcaatatttattgctgtcattattctcagtggagaccgcccaggtttg
ctgaatgtgaagcccattgaagacattcaagacaacctgctacaagccctggagctccag
ctgaagctgaaccaccctgagtcctcacagctgtttgccaagctgctccagaaaatgaca
gacctcagacagattgtcacggaacacgtgcagctactgcaggtgatcaagaagacggag
acagacatgagtcttcacccgctcctgcaggagatctacaaggacttgtactag

Protein Sequence

>5468 : length: 477
MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDP
VVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASG
FHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAI
RFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGK
TTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYA
KSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPF
GDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ
LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY



')