Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5460

Name

POU5F1

Synonym

OCT3|OCT4|OTF-3|OTF3|OTF4|Oct-3|Oct-4;POU class 5 homeobox 1;POU5F1;POU class 5 homeobox 1

Definition

POU domain transcription factor OCT4|POU domain, class 5, transcription factor 1|POU-type homeodomain-containing DNA-binding protein|octamer-binding protein 3|octamer-binding protein 4|octamer-binding transcription factor 3|octamer-binding transcription f

Position

6p21.31

Gene Type

protein-coding

Pathways and Diseases

Pathway

HIF-2-alpha transcription factor network;PID Curated;200030

External Links

Links to Entrez Gene

5460

Links to all GeneRIF Items

5460

Links to iHOP

5460

Sequence Information

Nucleotide Sequence

>5460 : length: 573
ctgggggttctatttgggaaggtattcagccaaacgaccatctgccgctttgaggctctg
cagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaa
gctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcgtgcaggcccga
aagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctg
cagtgcccgaaacccacactgcagcagatcagccacatcgcccagcagcttgggctcgag
aaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagc
gactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtg
tcctttcctctggccccagggccccattttggtaccccaggctatgggagccctcacttc
actgcactgtactcctcggtccctttccctgagggggaagcctttccccctgtctccgtc
accactctgggctctcccatgcattcaaactga

Protein Sequence

>5460 : length: 190
MGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQAR
KRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSS
DYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV
TTLGSPMHSN



')