Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5329

Name

PLAUR

Synonym

CD87|U-PAR|UPAR|URKR;plasminogen activator, urokinase receptor;PLAUR;plasminogen activator, urokinase receptor

Definition

monocyte activation antigen Mo3|u-plasminogen activator receptor form 2|urokinase plasminogen activator surface receptor

Position

19q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Attachment of GPI anchor to uPAR;PID Reactome;500547

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Dissolution of Fibrin Clot;PID Reactome;500304

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

Complement and coagulation cascades;KEGG PATHWAY;hsa04610

Pathway

Blood coagulation;PANTHER;P00011

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Metabolism of proteins;Reactome;REACT:17015

Pathway

FGF signaling pathway;PID Curated;200189

Pathway

Plasminogen activating cascade;PANTHER;P00050

Pathway

Arf6 downstream pathway;PID Curated;200079

Disease

Dermatitis;FunDO

Disease

Rheumatic fever;FunDO

Disease

Polycystic ovary syndrome;FunDO

Disease

Cancer;FunDO

Disease

HIV infection;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

5329

Links to all GeneRIF Items

5329

Links to iHOP

5329

Sequence Information

Nucleotide Sequence

>5329 : length: 846
atgggtcacccgccgctgctgccgctgctgctgctgctccacacctgcgtcccagcctct
tggggcctgcggtgcatgcagtgtaagaccaacggggattgccgtgtggaagagtgcgcc
ctgggacaggacctctgcaggaccacgatcgtgcgcttgtgggaagaaggagaagagctg
gagctggtggagaaaagctgtacccactcagagaagaccaacaggaccctgagctatcgg
actggcttgaagatcaccagccttaccgaggttgtgtgtgggttagacttgtgcaaccag
ggcaactctggccgggctgtcacctattcccgaagccgttacctcgaatgcatttcctgt
ggctcatcagacatgagctgtgagaggggccggcaccagagcctgcagtgccgcagccct
gaagaacagtgcctggatgtggtgacccactggatccaggaaggtgaagaagggcgtcca
aaggatgaccgccacctccgtggctgtggctaccttcccggctgcccgggctccaatggt
ttccacaacaacgacaccttccacttcctgaaatgctgcaacaccaccaaatgcaacgag
ggcccaatcctggagcttgaaaatctgccgcagaatggccgccagtgttacagctgcaag
gggaacagcacccatggatgctcctctgaagagactttcctcattgactgccgaggcccc
atgaatcaatgtctggtagccaccggcactcacgaacgctcactctggggaagctggttg
ccatgtaaaagtactactgccctgagaccaccatgctgtgaggaagcccaagctactcat
gtataa

Protein Sequence

>5329 : length: 281
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHERSLWGSWLPCKSTTALRPPCCEEAQATHV



')