Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5300

Name

PIN1

Synonym

DOD|UBL5;peptidylprolyl cis/trans isomerase, NIMA-interacting 1;PIN1;peptidylprolyl cis/trans isomerase, NIMA-interacting 1

Definition

PPIase Pin1|peptidyl-prolyl cis-trans isomerase NIMA-interacting 1|protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1|rotamase Pin1

Position

19p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

p53 pathway;PID Curated;200175

Pathway

C-MYC pathway;PID Curated;200093

Disease

Embryoma;FunDO

Disease

Neuroblastoma;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Neurodegenerative disorder;FunDO

Disease

Prostate cancer;FunDO

Disease

Alzheimer's disease;GAD

Disease

breast cancer;GAD

Disease

CANCER;GAD

Disease

Dental plaque;FunDO

Disease

NEUROLOGICAL;GAD

Disease

Breast cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Liver cancer;FunDO

Disease

Adenoid cystic cancer;FunDO

Disease

Brain disease;FunDO

External Links

Links to Entrez Gene

5300

Links to all GeneRIF Items

5300

Links to iHOP

5300

Sequence Information

Nucleotide Sequence

>5300 : length: 492
atggcggacgaggagaagctgccgcccggctgggagaagcgcatgagccgcagctcaggc
cgagtgtactacttcaaccacatcactaacgccagccagtgggagcggcccagcggcaac
agcagcagtggtggcaaaaacgggcagggggagcctgccagggtccgctgctcgcacctg
ctggtgaagcacagccagtcacggcggccctcgtcctggcggcaggagaagatcacccgg
accaaggaggaggccctggagctgatcaacggctacatccagaagatcaagtcgggagag
gaggactttgagtctctggcctcacagttcagcgactgcagctcagccaaggccagggga
gacctgggtgccttcagcagaggtcagatgcagaagccatttgaagacgcctcgtttgcg
ctgcggacgggggagatgagcgggcccgtgttcacggattccggcatccacatcatcctc
cgcactgagtga

Protein Sequence

>5300 : length: 163
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE



')