Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5290

Name

PIK3CA

Synonym

PI3K|p110-alpha;phosphoinositide-3-kinase, catalytic, alpha polypeptide;PIK3CA;phosphoinositide-3-kinase, catalytic, alpha polypeptide

Definition

PI3-kinase p110 subunit alpha|PI3-kinase subunit alpha|PI3K-alpha|PI3Kalpha|PtdIns-3-kinase p110|p110alpha|phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha|phosphatidylinositol 3-kinase, catalytic, alpha polypeptide|phosphatidylinositol-4,5-bisphos

Position

3q26.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Axon guidance mediated by netrin;PANTHER;P00009

Pathway

Phosphatidylinositol signaling system;KEGG PATHWAY;hsa04070

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

phospholipase c signaling pathway;PID BioCarta;100069

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

insulin signaling pathway;PID BioCarta;100124

Pathway

mtor signaling pathway;PID BioCarta;100101

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

egf signaling pathway;PID BioCarta;100181

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Inositol phosphate metabolism;KEGG PATHWAY;hsa00562

Pathway

the igf-1 receptor and longevity;PID BioCarta;100115

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

b cell survival pathway;PID BioCarta;100228

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

tpo signaling pathway;PID BioCarta;100012

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

trka receptor signaling pathway;PID BioCarta;100011

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

multiple antiapoptotic pathways from igf-1r signaling lead to bad phosphorylation;PID BioCarta;100135

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

human cytomegalovirus and map kinase pathways;PID BioCarta;100149

Pathway

3-phosphoinositide biosynthesis;BioCyc;PWY-6352

Pathway

growth hormone signaling pathway;PID BioCarta;100155

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

nerve growth factor pathway (ngf);PID BioCarta;100096

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

p53 pathway;PANTHER;P00059

Pathway

B cell activation;PANTHER;P00010

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Angiogenesis;PANTHER;P00005

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

transcription factor creb and its extracellular signals;PID BioCarta;100198

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Gab1 signalosome;PID Reactome;500514

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

corticosteroids and cardioprotection;PID BioCarta;100156

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

the co-stimulatory signal during t-cell activation;PID BioCarta;100193

Pathway

cxcr4 signaling pathway;PID BioCarta;100192

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Hemostasis;Reactome;REACT:604

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

akt signaling pathway;PID BioCarta;100245

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Carbohydrate digestion and absorption;KEGG PATHWAY;hsa04973

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

control of skeletal myogenesis by hdac and calcium/calmodulin-dependent kinase (camk);PID BioCarta;100148

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

Ras Pathway;PANTHER;P04393

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Keratosis, seborrheic, somatic;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Nonsmall cell lung cancer, somatic;OMIM

Disease

Ovarian cancer, somatic;OMIM

Disease

breast cancer;GAD

Disease

Colonic Neoplasms;GAD

Disease

Colorectal cancer, somatic;OMIM

Disease

Nevus, epidermal;OMIM

Disease

CANCER;GAD

Disease

Gastric cancer, somatic;OMIM

Disease

Ovarian cancer;KEGG DISEASE;H00027

Disease

Breast cancer, somatic;OMIM

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Hepatocellular carcinoma, somatic;OMIM

Disease

colorectal cancer;GAD

External Links

Links to Entrez Gene

5290

Links to all GeneRIF Items

5290

Links to iHOP

5290

Sequence Information

Nucleotide Sequence

>5290 : length: 3207
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttactcaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaacgtttgtaaagaagctgtggatcttagggacctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatctgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagctattcccacgcaggactgagtaacagactagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctatggagtcacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gcccagatgtattgcttggtaaaagattggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcctgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggaaaagctcattaacttaactgacattctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctgtctcctctaaaccctgctcatcaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatactgtgtagctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

Protein Sequence

>5290 : length: 1068
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN



')