Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5155

Name

PDGFB

Synonym

PDGF2|SIS|SSV|c-sis;platelet-derived growth factor beta polypeptide;PDGFB;platelet-derived growth factor beta polypeptide

Definition

PDGF subunit B|PDGF, B chain|PDGF-2|Platelet-derived growth factor, beta polypeptide (oncogene SIS)|becaplermin|platelet-derived growth factor 2|platelet-derived growth factor B chain|platelet-derived growth factor beta polypeptide (simian sarcoma viral (

Position

22q12.3-q13.1|22q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

transcriptional activation of dbpb from mrna;PID BioCarta;100190

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Hemostasis;Reactome;REACT:604

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Angiogenesis;PANTHER;P00005

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Giant-cell fibroblastoma;OMIM

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Systemic scleroderma;FunDO

Disease

Glioma;KEGG DISEASE;H00042

Disease

Bone marrow disease;FunDO

Disease

Cancer;FunDO

Disease

Meningioma, SIS-related;OMIM

Disease

Dermatofibrosarcoma protuberans;OMIM

Disease

Malignant pleural mesothelioma;KEGG DISEASE;H00015

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

5155

Links to all GeneRIF Items

5155

Links to iHOP

5155

Sequence Information

Nucleotide Sequence

>5155 : length: 726
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctttatgagatgctgagtgaccactcgatccgctcc
tttgatgatctccaacgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcttggctcgtggaaga
aggagcctgggttccctgaccattgctgagccggccatgatcgccgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaagaccacctggcatgcaagtgt
gagacagtggcagctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagacccttgga
gcctag

Protein Sequence

>5155 : length: 241
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A



')