Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

51474

Name

LIMA1

Synonym

EPLIN|SREBP3;LIM domain and actin binding 1;LIMA1;LIM domain and actin binding 1

Definition

1110021C24Rik|LIM domain and actin-binding protein 1|epithelial protein lost in neoplasm beta|sterol regulatory element binding protein 3

Position

12q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

External Links

Links to Entrez Gene

51474

Links to all GeneRIF Items

51474

Links to iHOP

51474

Sequence Information

Nucleotide Sequence

>51474 : length: 2283
atggaatcatctccatttaatagacggcaatggacctcactatcattgagggtaacagcc
aaagaactttctcttgtcaacaagaacaagtcatcggctattgtggaaatattctccaag
taccagaaagcagctgaagaaacaaacatggagaagaagagaagtaacaccgaaaatctc
tcccagcactttagaaaggggaccctgactgtgttaaagaagaagtgggagaacccaggg
ctgggagcagagtctcacacagactctctacggaacagcagcactgagattaggcacaga
gcagaccatcctcctgctgaagtgacaagccacgctgcttctggagccaaagctgaccaa
gaagaacaaatccaccccagatctagactcaggtcacctcctgaagccctcgttcagggt
cgatatccccacatcaaggacggtgaggatcttaaagaccactcaacagaaagtaaaaaa
atggaaaattgtctaggagaatccaggcatgaagtagaaaaatcagaaatcagtgaaaac
acagatgcttcgggcaaaatagagaaatataatgttccgctgaacaggcttaagatgatg
tttgagaaaggtgaaccaactcaaactaagattctccgggcccaaagccgaagtgcaagt
ggaaggaagatctctgaaaacagctattctctagatgacctggaaataggcccaggtcag
ttgtcatcttctacatttgactcggagaaaaatgagagtagacgaaatctggaacttcca
cgcctctcagaaacctctataaaggatcgaatggccaagtaccaggcagctgtgtccaaa
caaagcagctcaaccaactatacaaatgagctgaaagccagtggtggcgaaatcaaaatt
cataaaatggagcaaaaggagaatgtgcccccaggtcctgaggtctgcatcacccatcag
gaaggggaaaagatttctgcaaatgagaatagcctggcagtccgttccacccctgccgaa
gatgactccccaggtgactcccaggttaagagtgaggttcaacagcctgtccatcccaag
ccactaagtccagattccagagcctccagtctttctgaaagttctcctcccaaagcaatg
aagaagtttcaggcacctgcaagagagacctgcgtggaatgtcagaagacagtctatcca
atggagcgtctcttggccaaccagcaggtgtttcacatcagctgcttccgttgctcctat
tgcaacaacaaactcagtctaggaacatatgcatctttacatggaagaatctattgtaag
cctcacttcaatcaactctttaaatctaagggcaactatgatgaaggctttgggcacaga
ccacacaaggatctatgggcaagcaaaaatgaaaacgaagagattttggagagaccagcc
cagcttgcaaatgcaagggagacccctcacagcccaggggtagaagatgcccctattgct
aaggtgggtgtcctggctgcaagtatggaagccaaggcctcctctcagcaggagaaggaa
gacaagccagctgaaaccaagaagctgaggatcgcctggccaccccccactgaacttgga
agttcaggaagtgccttggaggaagggatcaaaatgtcaaagcccaaatggcctcctgaa
gacgaaatcagcaagcccgaagttcctgaggatgtcgatctagatctgaagaagctaaga
cgatcttcttcactgaaggaaagaagccgcccattcactgtagcagcttcatttcaaagc
acctctgtcaagagcccaaaaactgtgtccccacctatcaggaaaggctggagcatgtca
gagcagagtgaagagtctgtgggtggaagagttgcagaaaggaaacaagtggaaaatgcc
aaggcttctaagaagaatgggaatgtgggaaaaacaacctggcaaaacaaagaatctaaa
ggagagacagggaagagaagtaaggaaggtcatagtttggagatggagaatgagaatctt
gtagaaaatggtgcagactccgatgaagatgataacagcttcctcaaacaacaatctcca
caagaacccaagtctctgaattggtcgagttttgtagacaacacctttgctgaagaattc
actactcagaatcagaaatcccaggatgtggaactctgggagggagaagtggtcaaagag
ctctctgtggaagaacagataaagagaaatcggtattatgatgaggatgaggatgaagag
tga

Protein Sequence

>51474 : length: 760
MESSPFNRRQWTSLSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEETNMEKKRSNTENL
SQHFRKGTLTVLKKKWENPGLGAESHTDSLRNSSTEIRHRADHPPAEVTSHAASGAKADQ
EEQIHPRSRLRSPPEALVQGRYPHIKDGEDLKDHSTESKKMENCLGESRHEVEKSEISEN
TDASGKIEKYNVPLNRLKMMFEKGEPTQTKILRAQSRSASGRKISENSYSLDDLEIGPGQ
LSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKI
HKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSPGDSQVKSEVQQPVHPK
PLSPDSRASSLSESSPPKAMKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSY
CNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPHKDLWASKNENEEILERPA
QLANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELG
SSGSALEEGIKMSKPKWPPEDEISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQS
TSVKSPKTVSPPIRKGWSMSEQSEESVGGRVAERKQVENAKASKKNGNVGKTTWQNKESK
GETGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQEPKSLNWSSFVDNTFAEEF
TTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE



')