Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5141

Name

PDE4A

Synonym

DPDE2|PDE4|PDE46;phosphodiesterase 4A, cAMP-specific;PDE4A;phosphodiesterase 4A, cAMP-specific

Definition

cAMP-specific 3',5'-cyclic phosphodiesterase 4A|phosphodiesterase 4A, cAMP-specific (dunce|phosphodiesterase E2 dunce homolog, Drosophila|phosphodiesterase isozyme 4

Position

19p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Purine metabolism;KEGG PATHWAY;hsa00230

Pathway

Opioid Signalling;Reactome;REACT:15295

Pathway

Signaling by GPCR;Reactome;REACT:14797

Disease

Leukemia;FunDO

Disease

Chronic obstructive airway disease;FunDO

External Links

Links to Entrez Gene

5141

Links to all GeneRIF Items

5141

Links to iHOP

5141

Sequence Information

Nucleotide Sequence

>5141 : length: 2661
atggaacccccgaccgtcccctcggaaaggagcctgtctctgtcactgcccgggccccgg
gagggccaggccaccctgaagcctcccccgcagcacctgtggcggcagcctcggaccccc
atccgtatccagcagcgcggctactccgacagcgcggagcgcgccgagcgggagcggcag
ccgcaccggcccatagagcgcgccgatgccatggacaccagcgaccggcccggcctgcgc
acgacccgcatgtcctggccctcgtccttccatggcactggcaccggcagcggcggcgcg
ggcggaggcagcagcaggcgcttcgaggcagagaatgggccgacaccatctcctggccgc
agccccctggactcgcaggcgagcccaggactcgtgctgcacgccggggcggccaccagc
cagcgccgggagtccttcctgtaccgctcagacagcgactatgacatgtcacccaagacc
atgtcccggaactcatcggtcaccagcgaggcgcacgctgaagacctcatcgtaacacca
tttgctcaggtgctggccagcctccggagcgtccgtagcaacttctcactcctgaccaat
gtgcccgttcccagtaacaagcggtccccgctgggcggccccacccctgtctgcaaggcc
acgctgtcagaagaaacgtgtcagcagttggcccgggagactctggaggagctggactgg
tgtctggagcagctggagaccatgcagacctatcgctctgtcagcgagatggcctcgcac
aagttcaaaaggatgttgaaccgtgagctcacacacctgtcagaaatgagcaggtccgga
aaccaggtctcagagtacatttccacaacattcctggacaaacagaatgaagtggagatc
ccatcacccacgatgaaggaacgagaaaaacagcaagcgccgcgaccaagaccctcccag
ccgcccccgccccctgtaccacacttacagcccatgtcccaaatcacagggttgaaaaag
ttgatgcatagtaacagcctgaacaactctaacattccccgatttggggtgaagaccgat
caagaagagctcctggcccaagaactggagaacctgaacaagtggggcctgaacatcttt
tgcgtgtcggattacgctggaggccgctcactcacctgcatcatgtacatgatattccag
gagcgggacctgctgaagaaattccgcatccctgtggacacgatggtgacatacatgctg
acgctggaggatcactaccacgctgacgtggcctaccataacagcctgcacgcagctgac
gtgctgcagtccacccacgtactgctggccacgcctgcactagatgcagtgttcacggac
ctggagattctcgccgccctcttcgcggctgccatccacgatgtggatcaccctggggtc
tccaaccagttcctcatcaacaccaattcggagctggcgctcatgtacaacgatgagtcg
gtgctcgagaatcaccacctggccgtgggcttcaagctgctgcaggaggacaactgcgac
atcttccagaacctcagcaagcgccagcggcagagcctacgcaagatggtcatcgacatg
gtgctggccacggacatgtccaagcacatgaccctcctggctgacctgaagaccatggtg
gagaccaagaaagtgaccagctcaggggtcctcctgctagataactactccgaccgcatc
caggtcctccggaacatggtgcactgtgccgacctcagcaaccccaccaagccgctggag
ctgtaccgccagtggacagaccgcatcatggccgagttcttccagcagggtgaccgagag
cgcgagcgtggcatggaaatcagccccatgtgtgacaagcacactgcctccgtggagaag
tctcaggtgggttttattgactacattgtgcacccattgtgggagacctgggcggacctt
gtccacccagatgcccaggagatcttggacactttggaggacaaccgggactggtactac
agcgccatccggcagagcccatctccgccacccgaggaggagtcaagggggccaggccac
ccacccctgcctgacaagttccagtttgagctgacgctggaggaggaagaggaggaagaa
atatcaatggcccagataccgtgcacagcccaagaggcattgactgcgcagggattgtca
ggagtcgaggaagctctggatgcaaccatagcctgggaggcatccccggcccaggagtcg
ttggaagttatggcacaggaagcatccctggaggccgagctggaggcagtgtatttgaca
cagcaggcacagtccacaggcagtgcacctgtggctccggatgagttctcgtcccgggag
gaattcgtggttgctgtaagccacagcagcccctctgccctggctcttcaaagccccctt
ctccctgcttggaggaccctgtctgtttcagagcatgccccgggcctcccgggcctcccc
tccacggcggccgaggtggaggcccaacgagagcaccaggctgccaagagggcttgcagt
gcctgcgcagggacatttggggaggacacatccgcactcccagctcctggtggcgggggg
tcaggtggagaccctacctga

Protein Sequence

>5141 : length: 886
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT



')