Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

51176

Name

LEF1

Synonym

LEF-1|TCF10|TCF1ALPHA|TCF7L3;lymphoid enhancer-binding factor 1;LEF1;lymphoid enhancer-binding factor 1

Definition

T cell-specific transcription factor 1-alpha|TCF1-alpha

Position

4q23-q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

other metabolic traits;GAD

Disease

Sebaceous tumors, somatic;OMIM

Disease

METABOLIC;GAD

Disease

Other metabolic traits;NHGRI

External Links

Links to Entrez Gene

51176

Links to all GeneRIF Items

51176

Links to iHOP

51176

Sequence Information

Nucleotide Sequence

>51176 : length: 1116
atgccccaactctccggaggaggtggcggcggcgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcatcccgaagaggaaggcgatttagctgacatcaagtcttccttggtgaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccacgacaaggccagagaacaccccgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataacgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccctactttttatcccttgtct
ccgggtggtgttggacagatcaccccacctcttggctggttttcccatcatatgattccc
ggtcctcctggtccccacacaactggcatccctcatccagctattgtaacacctcaggtc
aaacaggaacatccccacactgacagtgacctaatgcacgtgaagcctcagcatgaacag
agaaaggagcaggagccaaaaagacctcacattaagaagcctctgaatgcttttatgtta
tacatgaaagaaatgagagcgaatgtcgttgctgagtgtactctaaaagaaagtgcagct
atcaaccagattcttggcagaaggtggcatgccctctcccgtgaagagcaggctaaatat
tatgaattagcacggaaagaaagacagctacatatgcagctttatccaggctggtctgca
agagacaattatggtaagaaaaagaagaggaagagagagaaactacaggaatctgcatca
ggtacaggtccaagaatgacagctgcctacatctga

Protein Sequence

>51176 : length: 371
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPHTTGIPHPAIVTPQV
KQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAA
INQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESAS
GTGPRMTAAYI



')