Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

51053

Name

GMNN

Synonym

Gem;geminin, DNA replication inhibitor;GMNN;geminin, DNA replication inhibitor

Definition

geminin

Position

6p22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Removal of licensing factors from origins;PID Reactome;500964

Pathway

DNA Replication;Reactome;REACT:383

Pathway

Association of licensing factors with the pre-replicative complex;PID Reactome;500987

Pathway

CDT1 association with the CDC6:ORC:origin complex;PID Reactome;500869

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

External Links

Links to Entrez Gene

51053

Links to all GeneRIF Items

51053

Links to iHOP

51053

Sequence Information

Nucleotide Sequence

>51053 : length: 630
atgaatcccagtatgaagcagaaacaagaagaaatcaaagagaatataaagaatagttct
gtcccaagaagaactctgaagatgattcagccttctgcatctggatctcttgttggaaga
gaaaatgagctgtccgcaggcttgtccaaaaggaaacatcggaatgaccacttaacatct
acaacttccagccctggggttattgtcccagaatctagtgaaaataaaaatcttggagga
gtcacccaggagtcatttgatcttatgattaaagaaaatccatcctctcagtattggaag
gaagtggcagaaaaacggagaaaggcgctgtatgaagcacttaaggaaaatgagaaactt
cataaagaaattgaacaaaaggacaatgaaattgcccgcctgaaaaaggagaataaagaa
ctggcagaagtagcagaacatgtacagtatatggcagagctaatagagagactgaatggt
gaacctctggataattttgaatcactggataatcaggaatttgattctgaagaagaaact
gttgaggattctctagtggaagactcagaaattggcacgtgtgctgaaggaactgtatct
tcctctacggatgcaaagccatgtatatga

Protein Sequence

>51053 : length: 209
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTS
TTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKL
HKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEET
VEDSLVEDSEIGTCAEGTVSSSTDAKPCI



')