Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5076

Name

PAX2

Synonym

-;paired box 2;PAX2;paired box 2

Definition

paired box homeotic gene 2|paired box protein Pax-2

Position

10q24

Gene Type

protein-coding

External Links

Links to Entrez Gene

5076

Links to all GeneRIF Items

5076

Links to iHOP

5076

Sequence Information

Nucleotide Sequence

>5076 : length: 1182
atggatatgcactgcaaagcagaccccttctccgcgatgcacccagggcacgggggtgtg
aaccagctcgggggggtgtttgtgaacggccggcccctacccgacgtggtgaggcagcgc
atcgtggagctggcccaccagggtgtgcggccctgtgacatctcccggcagctgcgggtc
agccacggctgtgtcagcaaaatcctgggcaggtactacgagaccggcagcatcaagccg
ggtgtgatcggtggctccaagcccaaagtggcgacgcccaaagtggtggacaagattgct
gaatacaaacgacagaacccgactatgttcgcctgggagattcgagaccggctcctggcc
gagggcatctgtgacaatgacacagtgcccagcgtctcttccatcaacagaatcatccgg
accaaagttcagcagcctttccacccaacgccggatggggctgggacaggagtgaccgcc
cctggccacaccattgttcccagcacggcctcccctcctgtttccagcgcctccaatgac
ccagtgggatcctactccatcaatgggatcctggggattcctcgctccaatggtgagaag
aggaaacgtgatgaagatgtgtctgagggctcagtccccaatggagattcccagagtggt
gtggacagtttgcggaagcacttgcgagctgacaccttcacccagcagcagctggaagct
ttggatcgggtctttgagcgtccttcctaccctgacgtcttccaggcatcagagcacatc
aaatcagaacaggggaacgagtactccctcccagccctgacccctgggcttgatgaagtc
aagtcgagtctatctgcatccaccaaccctgagctgggcagcaacgtgtcaggcacacag
acatacccagttgtgactggtcgtgacatggcgagcaccactctgcctggttacccccct
cacgtgccccccactggccagggaagctaccccacctccaccctggcaggaatggtgcct
gggagcgagttctccggcaacccgtacagccacccccagtacacggcctacaacgaggct
tggagattcagcaaccccgccttactaagttccccttattattatagtgccgccccccgg
tccgcccctgccgctgctgccgctgcctatgaccgccactag

Protein Sequence

>5076 : length: 393
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLA
EGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASND
PVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEA
LDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQ
TYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEA
WRFSNPALLSSPYYYSAAPRSAPAAAAAAYDRH



')