Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5058

Name

PAK1

Synonym

PAKalpha;p21 protein (Cdc42/Rac)-activated kinase 1;PAK1;p21 protein (Cdc42/Rac)-activated kinase 1

Definition

STE20 homolog, yeast|alpha-PAK|p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)|p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related)|p65-PAK|serine/threonine-protein kinase PAK 1

Position

11q13-q14

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Angiogenesis;PANTHER;P00005

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

T cell activation;PANTHER;P00053

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Signal transduction by L1;PID Reactome;500100

Pathway

fas signaling pathway (cd95);PID BioCarta;100167

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

S1P2 pathway;PID Curated;200181

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Aurora A signaling;PID Curated;200166

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Intraocular melanoma;FunDO

Disease

Renal Cell cancer;FunDO

Disease

Virus disease;FunDO

Disease

esophageal cancer;GAD

Disease

Embryoma;FunDO

Disease

Ovarian cancer;FunDO

Disease

CANCER;GAD

Disease

Dental plaque;FunDO

Disease

Breast cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Down syndrome;FunDO

External Links

Links to Entrez Gene

5058

Links to all GeneRIF Items

5058

Links to iHOP

5058

Sequence Information

Nucleotide Sequence

>5058 : length: 1662
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcactatgattggagccggcagcaaagatgctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccattttacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagat
tttgaacacacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcgaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattacaattcttctaatgccttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgctaccccaccaccagtgattgctccacgcccagagcacacaaaatctgta
tacacacggtctgtgattgaaccacttcctgtcactccaactcgggacgtggctacatct
cccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgag
aagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgct
tcaggcaccgtgtacacagcaatggatgtggccacaggacaggaggtggccattaagcag
atgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagctg
tgggttgttatggaatacttggctggaggctccttgacagatgtggtgacagaaacttgc
atggatgaaggccaaattgcagctgtgtgccgtgagtgtctgcaggctctggagttcttg
cattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggat
ggctctgtcaagctaactgactttggattctgtgcacagataaccccagagcagagcaaa
cggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacgaaaggcc
tatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggg
gagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtctcgagatggatgtggagaagagaggttcagctaaagagctgctacaggtgagaaaa
ctgaggtttcaagtgtttagtaacttttccatgatagctgcatcaattcctgaagattgc
caagcccctctccagcctcactccactgattgctgcagctaa

Protein Sequence

>5058 : length: 553
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQVRKLRFQVFSNFSMIAASIPEDC
QAPLQPHSTDCCS



')