Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

5052

Name

PRDX1

Synonym

MSP23|NKEFA|PAG|PAGA|PAGB|PRX1|PRXI|TDPX2;peroxiredoxin 1;PRDX1;peroxiredoxin 1

Definition

NKEF-A|natural killer cell-enhancing factor A|natural killer-enhancing factor A|peroxiredoxin-1|proliferation-associated gene A|proliferation-associated gene protein|thioredoxin peroxidase 2|thioredoxin-dependent peroxide reductase 2

Position

1p34.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Peroxisome;KEGG PATHWAY;hsa04146

Disease

Pick disease of the brain;FunDO

Disease

Esophageal disease;FunDO

Disease

Esophageal tumor;FunDO

Disease

Lung cancer;FunDO

Disease

Down syndrome;FunDO

Disease

Colon cancer;FunDO

Disease

Alzheimer's disease;FunDO

External Links

Links to Entrez Gene

5052

Links to all GeneRIF Items

5052

Links to iHOP

5052

Sequence Information

Nucleotide Sequence

>5052 : length: 600
atgtcttcaggaaatgctaaaattgggcaccctgcccccaacttcaaagccacagctgtt
atgccagatggtcagtttaaagatatcagcctgtctgactacaaaggaaaatatgttgtg
ttcttcttttaccctcttgacttcacctttgtgtgccccacggagatcattgctttcagt
gatagggcagaagaatttaagaaactcaactgccaagtgattggtgcttctgtggattct
cacttctgtcatctagcatgggtcaatacacctaagaaacaaggaggactgggacccatg
aacattcctttggtatcagacccgaagcgcaccattgctcaggattatggggtcttaaag
gctgatgaaggcatctcgttcaggggcctttttatcattgatgataagggtattcttcgg
cagatcactgtaaatgacctccctgttggccgctctgtggatgagactttgagactagtt
caggccttccagttcactgacaaacatggggaagtgtgcccagctggctggaaacctggc
agtgataccatcaagcctgatgtccaaaagagcaaagaatatttctccaagcagaagtga

Protein Sequence

>5052 : length: 199
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK



')