Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4921

Name

DDR2

Synonym

MIG20a|NTRKR3|TKT|TYRO10;discoidin domain receptor tyrosine kinase 2;DDR2;discoidin domain receptor tyrosine kinase 2

Definition

CD167 antigen-like family member B|cell migration-inducing protein 20|discoidin domain receptor 2|discoidin domain receptor family, member 2|discoidin domain-containing receptor 2|discoidin domain-containing receptor tyrosine kinase 2|hydroxyaryl-protein

Position

1q23.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

4921

Links to all GeneRIF Items

4921

Links to iHOP

4921

Sequence Information

Nucleotide Sequence

>4921 : length: 2568
atgatcctgattcccagaatgctcttggtgctgttcctgctgctgcctatcttgagttct
gcaaaagctcaggttaatccagctatatgccgctatcctctgggcatgtcaggaggccag
attccagatgaggacatcacagcttccagtcagtggtcagagtccacagctgccaaatat
ggaaggctggactcagaagaaggggatggagcctggtgccctgagattccagtggaacct
gatgacctgaaggagtttctgcagattgacttgcacaccctccattttatcactctggtg
gggacccaggggcgccatgcaggaggtcatggcatcgagtttgcccccatgtacaagatc
aattacagtcgggatggcactcgctggatctcttggcggaaccgtcatgggaaacaggtg
ctggatggaaatagtaacccctatgacattttcctaaaggacttggagccgcccattgta
gccagatttgtccggttcattccagtcaccgaccactccatgaatgtgtgtatgagagtg
gagctttacggctgtgtctggctagatggcttggtgtcttacaatgctccagctgggcag
cagtttgtactccctggaggttccatcatttatctgaatgattctgtctatgatggagct
gttggatacagcatgacagaagggctaggccaattgaccgatggtgtgtctggcctggac
gatttcacccagacccatgaataccacgtgtggcccggctatgactatgtgggctggcgg
aacgagagtgccaccaatggctacattgagatcatgtttgaatttgaccgcatcaggaat
ttcactaccatgaaggtccactgcaacaacatgtttgctaaaggtgtgaagatctttaag
gaggtacagtgctacttccgctctgaagccagtgagtgggaacctaatgccatttccttc
ccccttgtcctggatgacgtcaaccccagtgctcggtttgtcacggtgcctctccaccac
cgaatggccagtgccatcaagtgtcaataccattttgcagatacctggatgatgttcagt
gagatcaccttccaatcagatgctgcaatgtacaacaactctgaagccctgcccacctct
cctatggcacccacaacctatgatccaatgcttaaagttgatgacagcaacactcggatc
ctgattggctgcttggtggccatcatctttatcctcctggccatcattgtcatcatcctc
tggaggcagttctggcagaaaatgctggagaaggcttctcggaggatgctggatgatgaa
atgacagtcagcctttccctgccaagtgattctagcatgttcaacaataaccgctcctca
tcacctagtgaacaagggtccaactcgacttacgatcgcatctttccccttcgccctgac
taccaggagccatccaggctgatacgaaaactcccagaatttgctccaggggaggaggag
tcaggctgcagcggtgttgtgaagccagtccagcccagtggccctgagggggtgccccac
tatgcagaggctgacatagtgaacctccaaggagtgacaggaggcaacacatactcagtg
cctgccgtcaccatggacctgctctcaggaaaagatgtggctgtggaggagttccccagg
aaactcctaactttcaaagagaagctgggagaaggacagtttggggaggttcatctctgt
gaagtggagggaatggaaaaattcaaagacaaagattttgccctagatgtcagtgccaac
cagcctgtcctggtggctgtgaaaatgctccgagcagatgccaacaagaatgccaggaat
gattttcttaaggagataaagatcatgtctcggctcaaggacccaaacatcatccatcta
ttagctgtgtgtatcactgatgaccctctctgtatgatcactgaatacatggagaatgga
gatctcaatcagtttctttcccgccacgagccccctaattcttcctccagcgatgtacgc
actgtcagttacaccaatctgaagtttatggctacccaaattgcctctggcatgaagtac
ctttcctctcttaattttgttcaccgagatctggccacacgaaactgtttagtgggtaag
aactacacaatcaagatagctgactttggaatgagcaggaacctgtacagtggtgactat
taccggatccagggccgggcagtgctccctatccgctggatgtcttgggagagtatcttg
ctgggcaagttcactacagcaagtgatgtgtgggcctttggggttactttgtgggagact
ttcaccttttgtcaagaacagccctattcccagctgtcagatgaacaggttattgagaat
actggagagttcttccgagaccaagggaggcagacttacctccctcaaccagccatttgt
cctgactctgtgtataagctgatgctcagctgctggagaagagatacgaagaaccgtccc
tcattccaagaaatccaccttctgctccttcaacaaggcgacgagtga

Protein Sequence

>4921 : length: 855
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE



')