Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4920

Name

ROR2

Synonym

BDB|BDB1|NTRKR2;receptor tyrosine kinase-like orphan receptor 2;ROR2;receptor tyrosine kinase-like orphan receptor 2

Definition

neurotrophic tyrosine kinase receptor-related 2|tyrosine-protein kinase transmembrane receptor ROR2

Position

9q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling network;PID Curated;200055

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Disease

Brachydactyly, type B1;OMIM

Disease

Robinow syndrome, autosomal recessive;OMIM

External Links

Links to Entrez Gene

4920

Links to all GeneRIF Items

4920

Links to iHOP

4920

Sequence Information

Nucleotide Sequence

>4920 : length: 2832
atggcccggggctcggcgctcccgcggcggccgctgctgtgcatcccggccgtctgggcg
gccgccgcgcttctgctctcagtgtcccggacttcaggtgaagtggaggttctggatccg
aacgaccctttaggaccccttgatgggcaggacggcccgattccaactctgaaaggttac
tttctgaattttctggagccagtaaacaatatcaccattgtccaaggccagacggcaatt
ctgcactgcaaggtggcaggaaacccaccccctaacgtgcggtggctaaagaatgatgcc
ccggtggtgcaggagccgcggcggatcatcatccggaagacagaatatggttcacgactg
cgaatccaggacctggacacgacagacactggctactaccagtgcgtggccaccaacggg
atgaagaccattaccgccactggcgtcctgtttgtgcggctgggtccaacgcacagccca
aatcataactttcaggatgattaccacgaggatgggttctgccagccttaccggggaatt
gcctgtgcacgcttcattggcaaccggaccatttatgtggactcgcttcagatgcagggg
gagattgaaaaccgaatcacagcggccttcaccatgatcggcacgtctacgcacctgtcg
gaccagtgctcacagttcgccatcccatccttctgccacttcgtgtttcctctgtgcgac
gcgcgctcccggacacccaagccgcgtgagctgtgccgcgacgagtgcgaggtgctggag
agcgacctgtgccgccaggagtacaccatcgcccgctccaacccgctcatcctcatgcgg
cttcagctgcccaagtgtgaggcgctgcccatgcctgagagccccgacgctgccaactgc
atgcgcattggcatcccagccgagaggctgggccgctaccatcagtgctataacggctca
ggcatggattacagaggaacggcaagcaccaccaagtcaggccaccagtgccagccgtgg
gccctgcagcacccccacagccaccacctgtccagcacagacttccctgagcttggaggg
gggcacgcctactgccggaaccccggaggccagatggagggcccctggtgctttacgcag
aataaaaacgtacgcatggaactgtgtgacgtaccctcgtgtagtccccgagacagcagc
aagatggggattctgtacatcttggtccccagcatcgcaattccactggtcatcgcttgc
cttttcttcttggtttgcatgtgccggaataagcagaaggcatctgcgtccacaccgcag
cggcgacagctgatggcctcgcccagccaagacatggaaatgcccctcattaaccagcac
aaacaggccaaactcaaagagatcagcctgtctgcggtgaggttcatggaggagctggga
gaggaccggtttgggaaagtctacaaaggtcacctgttcggccctgccccgggggagcag
acccaggctgtggccatcaaaacgctgaaggacaaagcggaggggcccctgcgggaggag
ttccggcatgaggctatgctgcgagcacggctgcaacaccccaacgtcgtctgcctgctg
ggcgtggtgaccaaggaccagcccctgagcatgatcttcagctactgttcgcacggcgac
ctccacgaattcctggtcatgcgctcgccgcactcggacgtgggcagcaccgatgatgac
cgcacggtgaagtccgccctggagccccccgacttcgtgcaccttgtggcacagatcgcg
gcggggatggagtacctatccagccaccacgtggttcacaaggacctggccacccgcaat
gtgctagtgtacgacaagctgaacgtgaagatctcagacttgggcctcttccgagaggtg
tatgccgccgattactacaagctgctggggaactcgctgctgcctatccgctggatggcc
ccagaggccatcatgtacggcaagttctccatcgactcagacatctggtcctacggtgtg
gtcctgtgggaggtcttcagctacggcctgcagccctactgcgggtactccaaccaggat
gtggtggagatgatccggaaccggcaggtgctgccttgccccgatgactgtcccgcctgg
gtgtatgccctcatgatcgagtgctggaacgagttccccagccggcggccccgcttcaag
gacatccacagccggctccgagcctggggcaacctttccaactacaacagctcggcgcag
acctcgggggccagcaacaccacgcagaccagctccctgagcaccagcccagtgagcaat
gtgagcaacgcccgctacgtggggcccaagcagaaggccccgcccttcccacagccccag
ttcatccccatgaagggccagatcagacccatggtgcccccgccgcagctctacgtcccc
gtcaacggctaccagccggtgccggcctatggggcctacctgcccaacttctacccggtg
cagatcccaatgcagatggccccgcagcaggtgcctcctcagatggtccccaagcccagc
tcacaccacagtggcagtggctccaccagcacaggctacgtcaccacggccccctccaac
acatccatggcagacagggcagccctgctctcagagggcgctgatgacacacagaacgcc
ccagaagatggggcccagagcaccgtgcaggaagcagaggaggaggaggaaggctctgtc
ccagagactgagctgctgggggactgtgacactctgcaggtggacgaggcccaagtccag
ctggaagcttga

Protein Sequence

>4920 : length: 943
MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLL
GVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA



')