Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4904

Name

YBX1

Synonym

BP-8|CSDA2|CSDB|DBPB|MDR-NF1|NSEP-1|NSEP1|YB-1|YB1;Y box binding protein 1;YBX1;Y box binding protein 1

Definition

CBF-A|CCAAT-binding transcription factor I subunit A|DNA-binding protein B|EFI-A|Y-box transcription factor|Y-box-binding protein 1|enhancer factor I subunit A|major histocompatibility complex, class II, Y box-binding protein I|nuclease sensitive element

Position

1p34

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

transcriptional activation of dbpb from mrna;PID BioCarta;100190

Pathway

Gene Expression;Reactome;REACT:71

Pathway

mRNA Splicing - Major Pathway;PID Reactome;500866

External Links

Links to Entrez Gene

4904

Links to all GeneRIF Items

4904

Links to iHOP

4904

Sequence Information

Nucleotide Sequence

>4904 : length: 975
atgagcagcgaggccgagacccagcagccgcccgccgccccccccgccgcccccgccctc
agcgccgccgacaccaagcccggcactacgggcagcggcgcagggagcggtggcccgggc
ggcctcacatcggcggcgcctgccggcggggacaagaaggtcatcgcaacgaaggttttg
ggaacagtaaaatggttcaatgtaaggaacggatatggtttcatcaacaggaatgacacc
aaggaagatgtatttgtacaccagactgccataaagaagaataaccccaggaagtacctt
cgcagtgtaggagatggagagactgtggagtttgatgttgttgaaggagaaaagggtgcg
gaggcagcaaatgttacaggtcctggtggtgttccagttcaaggcagtaaatatgcagca
gaccgtaaccattatagacgctatccacgtcgtaggggtcctccacgcaattaccagcaa
aattaccagaatagtgagagtggggaaaagaacgagggatcggagagtgctcccgaaggc
caggcccaacaacgccggccctaccgcaggcgaaggttcccaccttactacatgcggaga
ccctatgggcgtcgaccacagtattccaaccctcctgtgcagggagaagtgatggagggt
gctgacaaccagggtgcaggagaacaaggtagaccagtgaggcagaatatgtatcgggga
tatagaccacgattccgcaggggccctcctcgccaaagacagcctagagaggacggcaat
gaagaagataaagaaaatcaaggagatgagacccaaggtcagcagccacctcaacgtcgg
taccgccgcaacttcaattaccgacgcagacgcccagaaaaccctaaaccacaagatggc
aaagagacaaaagcagccgatccaccagctgagaattcgtccgctcccgaggctgagcag
ggcggggctgagtaa

Protein Sequence

>4904 : length: 324
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL
GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG
QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG
YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE



')