Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4853

Name

NOTCH2

Synonym

AGS2|HJCYS|hN2;notch 2;NOTCH2;notch 2

Definition

Notch homolog 2|neurogenic locus notch homolog protein 2

Position

1p13-p11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;PANTHER;P00045

Pathway

Transport of Notch receptor precursor to golgi;PID Reactome;500111

Pathway

Mature Notch receptor trafficks to plasma membrane;PID Reactome;500113

Pathway

Signaling by Notch;PID Reactome;500110

Pathway

Notch receptor binds with a ligand;PID Reactome;500114

Pathway

A third proteolytic cleavage releases NICD;PID Reactome;500116

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

NICD trafficks to nucleus;PID Reactome;500117

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Signaling by Notch;Reactome;REACT:299

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Maturation of Notch precursor via proteolytic cleavage;PID Reactome;500112

Pathway

Dorso-ventral axis formation;KEGG PATHWAY;hsa04320

Pathway

Receptor-ligand binding initiates the second proteolytic cleavage of Notch receptor;PID Reactome;500115

Disease

Type 2 diabetes;NHGRI

Disease

diabetes, type 2;GAD

Disease

Metabolic diseases;KEGG DISEASE

Disease

METABOLIC;GAD

Disease

Type II diabetes mellitus;KEGG DISEASE;H00409

Disease

Alagille syndrome 2;OMIM

Disease

Diabetes;KEGG DISEASE

Disease

type 2 diabetes;GAD

External Links

Links to Entrez Gene

4853

Links to all GeneRIF Items

4853

Links to iHOP

4853

Sequence Information

Nucleotide Sequence

>4853 : length: 3708
atgcccgccctgcgccccgctctgctgtgggcgctgctggcgctctggctgtgctgcgcg
gcccccgcgcatgcattgcagtgtcgagatggctatgaaccctgtgtaaatgaaggaatg
tgtgttacctaccacaatggcacaggatactgcaaatgtccagaaggcttcttgggggaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacttgtgtg
gcccaggccatgctggggaaagccacgtgccgatgtgcctcagggtttacaggagaggac
tgccagtactcaacatctcatccatgctttgtgtctcgaccctgcctgaatggcggcaca
tgccatatgctcagccgggatacctatgagtgcacctgtcaagtcgggtttacaggtaag
gagtgccaatggacggatgcctgcctgtctcatccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcaaatgcctcacaggcttcacagggcagaaatgtgag
actgatgtcaatgagtgtgacattccaggacactgccagcatggtggcacctgcctcaac
ctgcctggttcctaccagtgccagtgccctcagggcttcacaggccagtactgtgacagc
ctgtatgtgccctgtgcaccctcaccttgtgtcaatggaggcacctgtcggcagactggt
gacttcacttttgagtgcaactgccttccaggttttgaagggagcacctgtgagaggaat
attgatgactgccctaaccacaggtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgtcccccacaatggacaggacagttctgcacagaggatgtggat
gaatgcctgctgcagcccaatgcctgtcaaaatgggggcacctgtgccaaccgcaatgga
ggctatggctgtgtatgtgtcaacggctggagtggagatgactgcagtgagaacattgat
gattgtgccttcgcctcctgtactccaggctccacctgcatcgaccgtgtggcctccttc
tcttgcatgtgcccagaggggaaggcaggtctcctgtgtcatctggatgatgcatgcatc
agcaatccttgccacaagggggcactgtgtgacaccaaccccctaaatgggcaatatatt
tgcacctgcccacaaggctacaaaggggctgactgcacagaagatgtggatgaatgtgcc
atggccaatagcaatccttgtgagcatgcaggaaaatgtgtgaacacggatggcgccttc
cactgtgagtgtctgaagggttatgcaggacctcgttgtgagatggacatcaatgagtgc
cattcagacccctgccagaatgatgctacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattagaaataaatgaatgtcagagc
aacccttgtgtgaacaatgggcagtgtgtggataaagtcaatcgtttccagtgcctgtgt
cctcctggtttcactgggccagtttgccagattgatattgatgactgttccagtactccg
tgtctgaatggggcaaagtgtatcgatcacccgaatggctatgaatgccagtgtgccaca
ggtttcactggtgtgttgtgtgaggagaacattgacaactgtgaccccgatccttgccac
catggtcagtgtcaggatggtattgattcctacacctgcatctgcaatcccgggtacatg
ggcgccatctgcagtgaccagattgatgaatgttacagcagcccttgcctgaacgatggt
cgctgcattgacctggtcaatggctaccagtgcaactgccagccaggcacgtcaggggtt
aattgtgaaattaattttgatgactgtgcaagtaacccttgtatccatggaatctgtatg
gatggcattaatcgctacagttgtgtctgctcaccaggattcacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgcaagggtgcaacatgtatcaacggt
gtgaatggtttccgctgtatatgccccgagggaccccatcaccccagctgctactcacag
gtgaacgaatgcctgagcaatccctgcatccatggaaactgtactggaggtctcagtgga
tataagtgtctctgtgatgcaggctgggttggcatcaactgtgaagtggacaaaaatgaa
tgcctttcgaatccatgccagaatggaggaacttgtgacaatctggtgaatggatacagg
tgtacttgcaagaagggctttaaaggctataactgccaggtgaatattgatgaatgtgcc
tcaaatccatgcctgaaccaaggaacctgctttgatgacataagtggctacacttgccac
tgtgtgctgccatacacaggcaagaattgtcagacagtattggctccctgttccccaaac
ccttgtgagaatgctgctgtttgcaaagagtcaccaaattttgagagttatacttgcttg
tgtgctcctggctggcaaggtcagcggtgtaccattgacattgacgagtgtatctccaag
ccctgcatgaaccatggtctctgccataacacccagggcagctacatgtgtgaatgtcca
ccaggcttcagtggtatggactgtgaggaggacattgatgactgccttgccaatccttgc
cagaatggaggttcctgtatggatggagtgaatactttctcctgcctctgccttccgggt
ttcactggggataagtgccagacagacatgaatgagtgtctgagtgaaccctgtaagaat
ggagggacctgctctgactacgtcaacagttacacttgcaagtgccaggcaggatttgat
ggagtccattgtgagaacaacatcaatgagtgcactgagagctcctgtttcaatggtggc
acatgtgttgatgggattaactccttctcttgcttgtgccctgtgggtttcactggatcc
ttctgcctccatgagatcaatgaatgcagctctcatccatgcctgaatgagggaacgtgt
gttgatggcctgggtacctaccgctgcagctgccccctgggctacactgggaaaaactgt
cagaccctggtgaatctctgcagtcggtctccatgtaaaaacaaaggtacttgcgttcag
aaaaaagcagagtcccagtgcctatgtccatctggatgggctggtgcctattgtgacgtg
cccaatgtctcttgtgacatagcagcctccaggagaggtgtgcttgttgaacacttgtgc
cagcactcaggtgtctgcatcaatgctggcaacacgcattactgtcagtgccccctgggc
tatactgggagctactgtgaggagcaactcgatgagtgtgcgtccaacccctgccagcac
ggggcaacatgcagtgacttcattggtggatacagatgcgagtgtgtcccaggctatcag
ggtgtcaactgtgagtatgaagtggatgagtgccagaatcagccctgccagaatggaggc
acctgtattgaccttgtgaaccatttcaagtgctcttgcccaccaggcactcggggtatg
aaatcatccttatccattttccatccagggcattgtcttaagttataa

Protein Sequence

>4853 : length: 1235
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGMKSSLSIFHPGHCLKL



')