Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4790

Name

NFKB1

Synonym

EBP-1|KBF1|NF-kappa-B|NF-kappaB|NFKB-p105|NFKB-p50|NFkappaB|p105|p50;nuclear factor of kappa light polypeptide gene enhancer in B-cells 1;NFKB1;nuclear factor of kappa light polypeptide gene enhancer in B-cells 1

Definition

DNA binding factor KBF1|DNA-binding factor KBF1|NF-kappabeta|nuclear factor NF-kappa-B p105 subunit|nuclear factor NF-kappa-B p50 subunit|nuclear factor kappa-B DNA binding subunit

Position

4q24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Interleukin-1 signaling;PID Reactome;500490

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

nf-kb signaling pathway;PID BioCarta;100097

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Regulated proteolysis of p75NTR;PID Reactome;500620

Pathway

Downstream TCR signaling;PID Reactome;500482

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Canonical NF-kappaB pathway;PID Curated;200026

Pathway

Alternative NF-kappaB pathway;PID Curated;200037

Pathway

NF-kB is activated and signals survival;PID Reactome;500615

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

inflammatory bowel disease;GAD

Disease

diabetes, type 1;GAD

Disease

IMMUNE;GAD

Disease

sarcoidosis;GAD

Disease

CANCER;GAD

Disease

melanoma;GAD

Disease

Arthritis, Psoriatic;GAD

Disease

Multiple Myeloma;GAD

Disease

ulcerative colitis;GAD

External Links

Links to Entrez Gene

4790

Links to all GeneRIF Items

4790

Links to iHOP

4790

Sequence Information

Nucleotide Sequence

>4790 : length: 2907
atggcagaagatgatccatatttgggaaggcctgaacaaatgtttcatttggatccttct
ttgactcatacaatatttaatccagaagtatttcaaccacagatggcactgccaacagat
ggcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactacctggtgcctctagtgaaaagaacaagaagtct
taccctcaggtcaaaatctgcaactatgtgggaccagcaaaggttattgttcagttggtc
acaaatggaaaaaatatccacctgcatgcccacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaactgctggacccaaggacatggtggtcggcttcgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggcg
tgtataaggggctataatcctggactcttggtgcaccctgaccttgcctatttgcaagca
gaaggtggaggggaccggcagctgggagatcgggaaaaagagctaatccgccaagcagct
ctgcagcagaccaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccggatagcactggcagcttcacaaggcgcctggaacccgtggtatcagacgccatctat
gacagtaaagcccccaatgcatccaacttgaaaattgtaagaatggacaggacagctgga
tgtgtgactggaggggaggaaatttatcttctttgtgacaaagttcagaaagatgacatc
cagattcgattttatgaagaggaagaaaatggtggagtctgggaaggatttggagatttt
tcccccacagatgttcatagacaatttgccattgtcttcaaaactccaaagtataaagat
attaatattacaaaaccagcctctgtgtttgtccagcttcggaggaaatctgacttggaa
actagtgaaccaaaacctttcctctactatcctgaaatcaaagataaagaagaagtgcag
aggaaacgtcagaagctcatgcccaatttttcggatagtttcggcggtggtagtggtgct
ggagctggaggcggaggcatgtttggtagtggcggtggaggagggggcactggaagtaca
ggtccagggtatagcttcccacactatggatttcctacttatggtgggattactttccat
cctggaactactaaatctaatgctgggatgaagcatggaaccatggacactgaatctaaa
aaggaccctgaaggttgtgacaaaagtgatgacaaaaacactgtaaacctctttgggaaa
gttattgaaaccacagagcaagatcaggagcccagcgaggccaccgttgggaatggtgag
gtcactctaacgtatgcaacaggaacaaaagaagagagtgctggagttcaggataacctc
tttctagagaaggctatgcagcttgcaaagaggcatgccaatgcccttttcgactacgcg
gtgacaggagacgtgaagatgctgctggccgtccagcgccatctcactgctgtgcaggat
gagaatggggacagtgtcttacacttagcaatcatccaccttcattctcaacttgtgagg
gatctactagaagtcacatctggtttgatttctgatgacattatcaacatgagaaatgat
ctgtaccagacgcccttgcacttggcagtgatcactaagcaggaagatgtggtggaggat
ttgctgagggctggggccgacctgagccttctggaccgcttgggtaactctgttttgcac
ctagctgccaaagaaggacatgataaagttctcagtatcttactcaagcacaaaaaggca
gcactacttcttgaccaccccaacggggacggtctgaatgccattcatctagccatgatg
agcaatagcctgccatgtttgctgctgctggtggccgctggggctgacgtcaatgctcag
gagcagaagtccgggcgcacagcactgcacctggctgtggagcacgacaacatctcattg
gcaggctgcctgctcctggagggtgatgcccatgtggacagtactacctacgatggaacc
acacccctgcatatagcagctgggagagggtccaccaggctggcagctcttctcaaagca
gcaggagcagatcccctggtggagaactttgagcctctctatgacctggatgactcttgg
gaaaatgcaggagaggatgaaggagttgtgcctggaaccacgcctctagatatggccacc
agctggcaggtatttgacatattaaatgggaaaccatatgagccagagtttacatctgat
gatttactagcacaaggagacatgaaacagctggctgaagatgtgaagctgcagctgtat
aagttactagaaattcctgatccagacaaaaactgggctactctggcgcagaaattaggt
ctggggatacttaataatgccttccggctgagtcctgctccttccaaaacacttatggac
aactatgaggtctctgggggtacagtcagagagctggtggaggccctgagacaaatgggc
tacaccgaagcaattgaagtgatccaggcagcctccagcccagtgaagaccacctctcag
gcccactcgctgcctctctcgcctgcctccacaaggcagcaaatagacgagctccgagac
agtgacagtgtctgcgacagcggcgtggagacatccttccgcaaactcagctttaccgag
tctctgaccagtggtgcctcactgctaactctcaacaaaatgccccatgattatgggcag
gaaggacctctagaaggcaaaatttag

Protein Sequence

>4790 : length: 968
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI



')