Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4613

Name

MYCN

Synonym

MODED|N-myc|NMYC|ODED|bHLHe37;v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian);MYCN;v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)

Definition

N-myc proto-oncogene protein|class E basic helix-loop-helix protein 37|neuroblastoma MYC oncogene|neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene|oncogene NMYC|pp65/67|v-myc avian myelocytomatosis viral related oncogene, neurobla

Position

2p24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;PANTHER;P00057

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Lung disease;FunDO

Disease

Neuroblastoma;KEGG DISEASE;H00043

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

Feingold syndrome;OMIM

Disease

Cancer;FunDO

Disease

rapid progression of neuroblastomas;GAD

Disease

Microcephaly and digital abnormalities with normal intelligence;OMIM

External Links

Links to Entrez Gene

4613

Links to all GeneRIF Items

4613

Links to iHOP

4613

Sequence Information

Nucleotide Sequence

>4613 : length: 1395
atgccgagctgctccacgtccaccatgccgggcatgatctgcaagaacccagacctcgag
tttgactcgctacagccctgcttctacccggacgaagatgacttctacttcggcggcccc
gactcgacccccccgggggaggacatctggaagaagtttgagctgctgcccacgcccccg
ctgtcgcccagccgtggcttcgcggagcacagctccgagcccccgagctgggtcacggag
atgctgcttgagaacgagctgtggggcagcccggccgaggaggacgcgttcggcctgggg
ggactgggtggcctcacccccaacccggtcatcctccaggactgcatgtggagcggcttc
tccgcccgcgagaagctggagcgcgccgtgagcgagaagctgcagcacggccgcgggccg
ccaaccgccggttccaccgcccagtccccgggagccggcgccgccagccctgcgggtcgc
gggcacggcggggctgcgggagccggccgcgccggggccgccctgcccgccgagctcgcc
cacccggccgccgagtgcgtggatcccgccgtggtcttcccctttcccgtgaacaagcgc
gagccagcgcccgtgcccgcagccccggccagtgccccggcggcgggccctgcggtcgcc
tcgggggcgggtattgccgccccagccggggccccgggggtcgcccctccgcgcccaggc
ggccgccagaccagcggcggcgaccacaaggccctcagtacctccggagaggacaccctg
agcgattcagatgatgaagatgatgaagaggaagatgaagaggaagaaatcgacgtggtc
actgtggagaagcggcgttcctcctccaacaccaaggctgtcaccacattcaccatcact
gtgcgtcccaagaacgcagccctgggtcccgggagggctcagtccagcgagctgatcctc
aaacgatgccttcccatccaccagcagcacaactatgccgccccctctccctacgtggag
agtgaggatgcacccccacagaagaagataaagagcgaggcgtccccacgtccgctcaag
agtgtcatccccccaaaggctaagagcttgagcccccgaaactctgactcggaggacagt
gagcgtcgcagaaaccacaacatcctggagcgccagcgccgcaacgaccttcggtccagc
tttctcacgctcagggaccacgtgccggagttggtaaagaatgagaaggccgccaaggtg
gtcattttgaaaaaggccactgagtatgtccactccctccaggccgaggagcaccagctt
ttgctggaaaaggaaaaattgcaggcaagacagcagcagttgctaaagaaaattgaacac
gctcggacttgctag

Protein Sequence

>4613 : length: 464
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC



')