Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4609

Name

MYC

Synonym

MRTL|bHLHe39|c-Myc;v-myc myelocytomatosis viral oncogene homolog (avian);MYC;v-myc myelocytomatosis viral oncogene homolog (avian)

Definition

avian myelocytomatosis viral oncogene homolog|class E basic helix-loop-helix protein 39|myc proto-oncogene protein|myc-related translation/localization regulatory factor|proto-oncogene c-Myc|transcription factor p64|v-myc avian myelocytomatosis viral onco

Position

8q24.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

C-MYC pathway;PID Curated;200093

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

erk1/erk2 mapk signaling pathway;PID BioCarta;100170

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Kidney failure;FunDO

Disease

Epstein-Barr virus infection;FunDO

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

kidney transplant;GAD

Disease

breast cancer;GAD

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

Leukoencephalopathy;FunDO

Disease

Werner syndrome;FunDO

Disease

colorectal carcinomas;GAD

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

Acute lymphoblastic leukemia (ALL) (Precursor T lymphoblastic leukemia);KEGG DISEASE;H00002

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Rheumatoid arthritis;FunDO

Disease

Kaposi's sarcoma;KEGG DISEASE;H00041

Disease

Choriocarcinoma;KEGG DISEASE;H00028

Disease

Viral infections;KEGG DISEASE

Disease

hepatocellular carcinomas;GAD

Disease

Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001

Disease

Urinary bladder cancer;NHGRI

Disease

Breast cancer;KEGG DISEASE;H00031

Disease

Synovitis;FunDO

Disease

Ovarian cancer;KEGG DISEASE;H00027

Disease

Adenovirus infection;FunDO

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

CANCER;GAD

Disease

Oral cancer;KEGG DISEASE;H00016

Disease

Infections caused by dsDNA viruses;KEGG DISEASE

Disease

Laryngeal cancer;KEGG DISEASE;H00055

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

urinary bladder cancer;GAD

Disease

Cancers;KEGG DISEASE

Disease

Small cell lung cancer;KEGG DISEASE;H00013

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Burkitt lymphoma;KEGG DISEASE;H00008

Disease

Osteosarcoma;KEGG DISEASE;H00036

Disease

Hemophilia;FunDO

Disease

Head and neck cancers;KEGG DISEASE

Disease

Ovarian cancer;NHGRI

Disease

Burkitt lymphoma;OMIM

Disease

RENAL;GAD

External Links

Links to Entrez Gene

4609

Links to all GeneRIF Items

4609

Links to iHOP

4609

Sequence Information

Nucleotide Sequence

>4609 : length: 1365
ctggatttttttcgggtagtggaaaaccagcagcctcccgcgacgatgcccctcaacgtt
agcttcaccaacaggaactatgacctcgactacgactcggtgcagccgtatttctactgc
gacgaggaggagaacttctaccagcagcagcagcagagcgagctgcagcccccggcgccc
agcgaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccctagccgc
cgctccgggctctgctcgccctcctacgttgcggtcacacccttctcccttcggggagac
aacgacggcggtggcgggagcttctccacggccgaccagctggagatggtgaccgagctg
ctgggaggagacatggtgaaccagagtttcatctgcgacccggacgacgagaccttcatc
aaaaacatcatcatccaggactgtatgtggagcggcttctcggccgccgccaagctcgtc
tcagagaagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgaaccccgcc
cgcggccacagcgtctgctccacctccagcttgtacctgcaggatctgagcgccgccgcc
tcagagtgcatcgacccctcggtggtcttcccctaccctctcaacgacagcagctcgccc
aagtcctgcgcctcgcaagactccagcgccttctctccgtcctcggattctctgctctcc
tcgacggagtcctccccgcagggcagccccgagcccctggtgctccatgaggagacaccg
cccaccaccagcagcgactctgaggaggaacaagaagatgaggaagaaatcgatgttgtt
tctgtggaaaagaggcaggctcctggcaaaaggtcagagtctggatcaccttctgctgga
ggccacagcaaacctcctcacagcccactggtcctcaagaggtgccacgtctccacacat
cagcacaactacgcagcgcctccctccactcggaaggactatcctgctgccaagagggtc
aagttggacagtgtcagagtcctgagacagatcagcaacaaccgaaaatgcaccagcccc
aggtcctcggacaccgaggagaatgtcaagaggcgaacacacaacgtcttggagcgccag
aggaggaacgagctaaaacggagcttttttgccctgcgtgaccagatcccggagttggaa
aacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcatacatcctgtcc
gtccaagcagaggagcaaaagctcatttctgaagaggacttgttgcggaaacgacgagaa
cagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

Protein Sequence

>4609 : length: 454
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA



')