Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4585

Name

MUC4

Synonym

ASGP|HSA276359|MUC-4;mucin 4, cell surface associated;MUC4;mucin 4, cell surface associated

Definition

ascites sialoglycoprotein|mucin 4, tracheobronchial|mucin-4|pancreatic adenocarcinoma mucin|testis mucin|tracheobronchial mucin

Position

3q29

Gene Type

protein-coding

External Links

Links to Entrez Gene

4585

Links to all GeneRIF Items

4585

Links to iHOP

4585

Sequence Information

Nucleotide Sequence

>4585 : length: 3531
atgaagggggcacgctggaggagggtcccctgggtgtccctgagctgcctgtgtctctgc
ctccttccgcatgtggtcccaggaatgacaacaccgtcactgaagacagacggtgggaga
cgcacagccacatcaccaccccccacaacctcccagaccatcatttccaccattcccagc
actgccatgcacacccgctccacagctgcccccatccccatcctgcctgagagaggagtt
tccctcttcccctatggggcaggcgccggggacctggagttcgtcaggaggaccgtggac
ttcacctccccactcttcaagccggcgactggcttcccccttggctcctctctccgtgat
tccctctacttcacagacaatggccagatcatcttcccagagtcagactaccagattttc
tcctaccccaacccactcccaacaggcttcacaggccgggaccctgtggccctggtggct
ccgttctgggacgatgctgacttctccactggtcgggggaccacattttatcaggaatac
gagacgttctatggtgaacacagcctgctagtccagcaggccgagtcttggattagaaag
atgacaaacaacgggggctacaaggccaggtgggccctaaaggtcacgtgggtcaatgcc
cacgcctatcctgcccagtggaccctcgggagcaacacctaccaagccatcctctccacg
gacgggagcaggtcctatgccctgtttctctaccagagcggtgggatgcagtgggacgtg
gcccagcgctcaggcaacccggtgctcatgggcttctctagtggagatggctatttcgaa
aacagcccactgatgtcccagccagtgtgggagaggtatcgccctgatagattcctgaat
tccaactcaggcctccaagggctgcagttctacaggctacaccgggaagaaaggcccaac
taccgtctcgagtgcctgcagtggctgaagagccagcctcggtggcccagctggggctgg
aaccaggtctcctgcccttgttcctggcagcagggacgacgggacttacgattccaaccc
gtcagcataggtcgctggggcctcggcagtaggcagctgtgcagcttcacctcttggcga
ggaggcgtgtgctgcagctacgggccctggggagagtttcgtgaaggctggcacgtgcag
cgtccttggcagttggcccaggaactggagccacagagctggtgctgccgctggaatgac
aagccctacctctgtgccctgtaccagcagaggcggccccacgtgggctgtgctacatac
aggcccccacagcccgcctggatgttcggggacccccacatcaccaccttggatggtgtc
agttacaccttcaatgggctgggggacttcctgctggtcggggcccaagacgggaactcc
tccttcctgcttcagggccgcaccgcccagactggctcagcccaggccaccaacttcatc
gcctttgcggctcagtaccgctccagcagcctgggccccgtcacggtccaatggctcctt
gagcctcacgacgcaatccgtgtcctgctggataaccagactgtgacatttcagcctgac
catgaagacggcggaggccaggagacgttcaacgccaccggagtcctcctgagccgcaac
ggctctgaggtctcggccagcttcgacggctgggccaccgtctcggtgatcgcgctctcc
aacatcctccacgcctccgccagcctcccgcccgagtaccagaaccgcacggaggggctc
ctgggggtctggaataacaatccagaggacgacttcaggatgcccaatggctccaccatt
cccccagggagccctgaggagatgcttttccactttggaatgacctggcagatcaacggg
acaggcctccttggcaagaggaatgaccagctgccttccaacttcacccctgttttctac
tcacaactgcaaaaaaacagctcctgggctgaacatttgatctccaactgtgacggagat
agctcatgcatctatgacaccctggccctgcgcaacgcaagcatcggacttcacacgagg
gaagtcagtaaaaactacgagcaggcgaacgccaccctcaatcagtacccgccctccatc
aatggtggtcgtgtgattgaagcctacaaggggcagaccacgctgattcagtacaccagc
aatgctgaggatgccaacttcacgctcagagacagctgcaccgacttggagctctttgag
aatgggacgttgctgtggacacccaagtcgctggagccattcactctggagattctagca
agaagtgccaagattggcttggcatctgcactccagcccaggactgtggtctgccattgc
aatgcagagagccagtgtttgtacaatcagaccagcagggtgggcaactcctccctggag
gtggctggctgcaagtgtgacgggggcaccttcggccgctactgcgagggctccgaggat
gcctgtgaggagccgtgcttcccgagtgtccactgcgttcctgggaagggctgcgaggcc
tgccctccaaacctgactggggatgggcggcactgtgcggctctggggagctctttcctg
tgtcagaaccagtcctgccctgtgaattactgctacaatcaaggccactgctacatctcc
cagactctgggctgtcagcccatgtgcacctgccccccagccttcactgacagccgctgc
ttcctggctgggaacaacttcagtccaactgtcaacctagaacttcccttaagagtcatc
cagctcttgctcagtgaagaggaaaatgcctccatggcagaagtcaacgcctcggtggca
tacagactggggaccctggacatgcgggcctttctccgcaacagccaagtggaacgaatc
gattctgcagcaccggcctcgggaagccccatccaacactggatggtcatctcggagttc
cagtaccgccctcggggcccggtcattgacttcctgaacaaccagctgctggccgcggtg
gtggaggcgttcttataccacgttccacggaggagtgaggagcccaggaacgacgtggtc
ttccagcccatctccggggaagacgtgcgcgatgtgacagccctgaacgtgagcacgctg
aaggcttacttcagatgcgatggctacaagggctacgacctggtctacagcccccagagc
ggcttcacctgcgtgtccccgtgcagtaggggctactgtgaccatggaggccagtgccag
cacctgcccagtgggccccgctgcagctgtgtgtccttctccatctacacggcctggggc
gagcactgtgagcacctgagcatgaaactcgacgcgttcttcggcatcttctttggggcc
ctgggcggcctcttgctgctgggggtcgggacgttcgtggtcctgcgcttctggggttgc
tccggggccaggttctcctatttcctgaactcagctgaggccttgccttga

Protein Sequence

>4585 : length: 1176
MKGARWRRVPWVSLSCLCLCLLPHVVPGMTTPSLKTDGGRRTATSPPPTTSQTIISTIPS
TAMHTRSTAAPIPILPERGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRD
SLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEY
ETFYGEHSLLVQQAESWIRKMTNNGGYKARWALKVTWVNAHAYPAQWTLGSNTYQAILST
DGSRSYALFLYQSGGMQWDVAQRSGNPVLMGFSSGDGYFENSPLMSQPVWERYRPDRFLN
SNSGLQGLQFYRLHREERPNYRLECLQWLKSQPRWPSWGWNQVSCPCSWQQGRRDLRFQP
VSIGRWGLGSRQLCSFTSWRGGVCCSYGPWGEFREGWHVQRPWQLAQELEPQSWCCRWND
KPYLCALYQQRRPHVGCATYRPPQPAWMFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNS
SFLLQGRTAQTGSAQATNFIAFAAQYRSSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPD
HEDGGGQETFNATGVLLSRNGSEVSASFDGWATVSVIALSNILHASASLPPEYQNRTEGL
LGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFY
SQLQKNSSWAEHLISNCDGDSSCIYDTLALRNASIGLHTREVSKNYEQANATLNQYPPSI
NGGRVIEAYKGQTTLIQYTSNAEDANFTLRDSCTDLELFENGTLLWTPKSLEPFTLEILA
RSAKIGLASALQPRTVVCHCNAESQCLYNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSED
ACEEPCFPSVHCVPGKGCEACPPNLTGDGRHCAALGSSFLCQNQSCPVNYCYNQGHCYIS
QTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVA
YRLGTLDMRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAV
VEAFLYHVPRRSEEPRNDVVFQPISGEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQS
GFTCVSPCSRGYCDHGGQCQHLPSGPRCSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGA
LGGLLLLGVGTFVVLRFWGCSGARFSYFLNSAEALP



')